Thu, Sep 24, 2026Fall (Semester 1) · Week 5Day 23 of 7780-min blockCalendar fit

ELISA lab report submission

Essential question: What must we understand about lab report submission to act on it?Enduring understanding: Reasoning from evidence about lab report submission is how a clinician moves from an observation to a decision.

Safety gate · before any work

  • Wear the required PPE, keep the bench clear, handle equipment only as directed, and know where the eyewash, sink, and spill kit are before you start.
  • Human samples and data stay private: label with a code, never a name, and dispose of materials in the correct waste container, then wash your hands.

Do now

Submit a full ELISA lab report interpreting your controls, results, and the test's reliability.

DueTonight, 11:29 PM
Hand in
Full ELISA lab report: plate photo, data table, claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.
Where
Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not.

You get two school days for every day you were absent, so this deadline moves with you.

Where you are · this course
Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. ELISA lab report submission ▸ Day 5
Day 23 of 77 this semester54 left before WebXam
🧬 Where you are · PLTW
Medical InterventionsUnit 1: How to Fight Infection ▸ Lesson 1.1 The Mystery Infection"Activity 1.1.5 ELISA", "Activity 1.1.6 Final Diagnosis"
Matched to your live myPLTW course (verified June 2026).
Today's driving question

Submit a full lab report interpreting your controls, results, and the test's reliability.

Today you'll be able to

Submit a full lab report interpreting your controls, results, and the test's reliability.

You've got it when
  • You will be able to submit a complete lab report.
  • You will be able to interpret results using controls.
  • You will be able to discuss sensitivity, specificity, and limitations.
Due today · Lab report RequiredFull lab report: plate photo, , claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.
Do-Now · start these with your notes closed
  1. What do you already know about lab report submission?
  2. What would you need to find out to answer today's question?
Do this · step by step
numbered so we can always find our place
  1. 1Assemble your plate photo, color , and control results.
  2. 2Write a Claim about which samples were positive and a Reasoning paragraph using your data.
  3. 3Discuss the test's sensitivity and specificity based on your run.
  4. 4Add one sentence on a limitation or error in your procedure.
  5. 5Submit the report on the class site.
  6. 6Confirm it is turned in and note one improvement for next time.
Interrupted or lost? If you were interrupted, reread the last line you wrote, then answer: which step am I on, and did I finish it? Start again from that step.
Optional project open: 072130 Molecular Lab Review - solo or group, about 1.5 to 2 hours total. Due by Fri, Jan 15, 2027. Great WebXam prep.
The story

What did this day actually feel like?

ELISA lab report submission

Plate layout, raw absorbance, standard curve, unknowns, and a limitations paragraph about my unsteady first row.

Turned in: lab report → Lab Reports folder

Fiction. There is no such student. The lessons, labs and dates are the real planned course; the student, the classmates and the conversations are invented.

The comic

The same day, drawn.

Drawing, panel 29: ELISA lab report submission.

Plate layout, raw absorbance, standard curve, unknowns, and a limitations paragraph about my unsteady first row.

Panel 29ELISA lab report submission · 2026-09-24
Read week 6, 5 panels

Fiction. There is no such student. The lessons, labs and dates are the real planned course; the student, the classmates and the conversations are invented.

🛠 Get unstuck · pick your level

Run the lab
Work the posted parallel example, reasoning shown, then start your own case.
Absent? Async catch-up
Stuck? Name where your thinking split from the example, then redo just that step.

Lab day: Tier 1 is the whole class at the bench. No extension today.

🔑 Today's words · 5

positive controlnegative controlspecificitysensitivityprimary antibody
+1 more in the word bank

Tap a word in the lesson for a plain meaning and one example. Recycled into next week's Do-Now.

Today's study notebook
Serial dilution, antibodies, and the ELISA test for detecting a target in a sample.
Open the notebook
Watch first: today's 1-minute intro
Audio overviewVideo overviewMind mapStudy guideFlashcardsQuizData table
Where this fits
Tested on (Ohio WebXam)
Genetics of Disease · 072130
PLTW lesson
MI · Lesson 1.1 The Mystery Infection
WebXam domain
Bio-Molecular Technology
Evidence to produce
Lab report
Lab / skill
HHMI BioInteractive (preview; use fallback if blocked)
Do the work · 80-minute blockfirst 5 min = hook

💡 Big idea: How does a complete lab report turn raw data into a reliable scientific conclusion?

  1. 0-12 minAssemble materials: plate photo, color , control results, and 2x2 classification table from Thursday
  2. 12-27 minDraft the Claim: one sentence naming which samples were positive, supported by control validation
  3. 27-47 minWrite the Reasoning paragraph: cite well colors, control results, and at least one sensitivity/specificity observation
  4. 47-60 minAdd the sensitivity and specificity discussion: was the run high-sensitivity, high-specificity, or mixed? Cite evidence
  5. 60-70 minWrite the limitation sentence: one specific procedural error or source of uncertainty
  6. 70-80 minSubmit on the class site; confirm all items show as turned in
Mr. Mendoza's 5-minute intro
  • This report represents the full arc of the unit: from bioethics Monday to wet lab Wednesday to quantitative analysis Thursday.
  • A lab report that only says 'the test worked' is not science; it must say how well it worked, how you know, and where it could fail.
  • You have every piece you need; today is about assembly, precision, and submission.
  • Exit goal: report submitted and confirmed as turned in before you leave.
Know by the end
  • A complete lab report integrates visual evidence (photo), quantitative data (table), and analytical interpretation into one coherent argument.
  • Discussing sensitivity and specificity in the report shows you can evaluate the quality of your own results, not just report them.
  • Naming a specific limitation shows scientific integrity: all methods have constraints, and acknowledging them is required for credibility.
Open this PLTW section today

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · lab report submission

Day 5 of this lesson. Open this exact section in myPLTW (find it in Clever, Microsoft sign-in), then do the work below.

Do this: Open Activity 1.1.6 Final Diagnosis in myPLTW and use your results to complete the diagnosis.

Complete

Submit your final diagnosis report citing your concentration estimate and evidence.

How far to get

should be done (Thursday); final diagnosis report submitted and confirmed today.

Upload as evidence

Final diagnosis report submission visible in the course shell.

The official PLTW activity stays inside myPLTW. If myPLTW will not open, use F1 and E1-E3 on this page to complete today's local evidence decision, then make up the official activity when access returns. Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not.

Today's PLTW tracker · fill in and submit

Check things off as you work, then submit. This tells Mr. Mendoza how you're doing so he can help the class. It does not replace turning in your producible through the submission route shown below.

Use the code Mr. Mendoza gave you, not your name. Saved on this device.

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic.Day 5 of this projectSee the full week plan
Today's PLTW target

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · ELISA lab report submission

Open Activity 1.1.6 Final Diagnosis in myPLTW and use your results to complete the diagnosis.

should be done (Thursday); final diagnosis report submitted and confirmed today.

This is how Mr. Mendoza sees the class keeping pace with PLTW. Be honest, it only helps if it is accurate.

1 · What you do today

🎯 Submit a full lab report interpreting your controls, results, and the test's reliability.

  • Assemble your plate photo, color , and control results.
  • Write a Claim about which samples were positive and a Reasoning paragraph using your data.
  • Discuss the test's sensitivity and specificity based on your run.
  • Add one sentence on a limitation or error in your procedure.
  • Submit the report on the class site.
  • Confirm it is turned in and note one improvement for next time.
2 · What you turn in

Lab report: Full lab report: plate photo, , claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.

Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not. Use the checklist just below and upload by 11:29 PM for full credit. Absent with an excused absence? You get two school days for every day you were absent, so this deadline moves with you.

3 · Who's doing what (team)
TaskWho
Assemble your plate photo, color , and control results._______
Write a Claim about which samples were positive and a Reasoning paragraph using your data._______
Discuss the test's sensitivity and specificity based on your run._______
Add one sentence on a limitation or error in your procedure._______
Submit the report on the class site._______
Confirm it is turned in and note one improvement for next time._______

Working solo? Put your own name in "Who" for every row.

4 · Words I can use correctly
5 · I'm successful today when I can…
  • You will be able to submit a complete lab report.
  • You will be able to interpret results using controls.
  • You will be able to discuss sensitivity, specificity, and limitations.
6 · Reflection & next steps
Where are you today?0/9 checked
Pick your period and code first.
Your 4 steps today
  1. 1
    Do this
    Submit a full ELISA lab report interpreting your controls, results, and the test's reliability.
  2. 2
  3. 3
    Submit this
    Lab report: Full ELISA lab report: plate photo, data table, claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.
  4. 4
    Submit it here
    1. 1Open the drop folder.
    2. 2Sign in with your district Microsoft account, not a personal one.
    3. 3Upload the file, named Lastname_Firstname__Assignment Title.
    4. 4Your own upload panel says Uploaded with a green check: that is your receipt.
    Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not. Genetics of Disease (Medical Interventions) › Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. › Lab report
    Open the drop folder
Were you absent? Jump to the make-up plan
Learn it · deck, reading, and vocabulary
Socratic teaching slide deck

The deck carries the prior idea forward, lets you inspect an analogy, maps the rule to biology, and ends with the same evidence decision and exit ticket used on this page.

Generated from this lesson's canonical data with a red-team citation check.

Carry forward

Sensitivity and specificity trade off against each other, so the right balance is set by whether missing a sick person or alarming a healthy one causes more harm for that disease.

Daily take-home

How does a complete lab report turn raw data into a reliable scientific conclusion?

Inspect the analogy

A smoke alarm detects signs of fire but can also react to burnt toast.

  1. What does the alarm detect?
  2. What creates a false alarm?
  3. What evidence is needed before declaring a fire?
Rule

A screening signal changes what to investigate next; it does not automatically prove the cause.

Where it breaks

Biomedical tests have measured performance and biological sampling limits that a household alarm does not capture.

Map the analogy to biology
  • Alarm signal maps to a test result.
  • Burnt toast maps to a .
  • Inspection maps to confirmation or the next test.
Read this first

Driving question: Submit a full lab report interpreting your controls, results, and the test's reliability.

What you already know: Sensitivity and specificity trade off against each other, so the right balance is set by whether missing a sick person or alarming a healthy one causes more harm for that disease.

New idea: How does a complete lab report turn raw data into a reliable scientific conclusion?

Visual or model: F1. F1. A lesson illustration or teaching diagram for ELISA lab report submission. Use it with E1-E3; it is a model or context image, not experimental or patient data. What to notice: Trace the labeled testing, treatment, or biological process and identify where evidence limits the decision.

  1. Observe or measure the relevant feature in lab report submission.
  2. Organize the observation with a stable evidence ID.
  3. Apply this rule: A screening signal changes what to investigate next; it does not automatically prove the cause.
  4. Choose the option the evidence supports and state the limit of the conclusion.

Real biomedical example: Submit a full lab report interpreting your controls, results, and the test's reliability.

What the evidence supports: E1-E3 and F1 support the daily take-home when the response meets the stated success criteria.

What it cannot prove: The package does not support claims beyond this lesson's or any real patient diagnosis.

Vocabulary:
  • : A sample known to produce a result, included in an experiment to confirm that the test is working correctly.
  • : A sample in an experiment expected to show no effect, used as a baseline to confirm that any result in the test sample is real.
  • specificity: A test's ability to correctly identify people who do not have a condition, giving few false positives.
  • sensitivity: A test's ability to correctly identify people who truly have a disease, measured as the share of real cases that the test flags as positive.
  • : The first added in a test that binds directly to the target molecule, marking it so it can be detected later.
  • : An that binds to a and carries a tag, such as a dye or , to make the target visible in a test.

Use it now: Choose one decision option. Cite E1 and E3, then explain how the rule connects the evidence to your choice.

Go further, optional: The source links below are optional enrichment. Every fact required for today's local evidence decision appears in this lesson package.

Evidence set and decision
E1 · Observation

A complete lab report integrates visual evidence (photo), quantitative data (table), and analytical interpretation into one coherent argument.

Limit: E1 supplies context or an observation; it does not by itself establish the explanation.

E2 · Mechanism

How does a complete lab report turn raw data into a reliable scientific conclusion?

Limit: E2 is a teaching statement or comparison and must be checked against the task evidence.

E3 · Result

You will be able to submit a complete lab report.

Limit: E3 supports only the result or product criterion named here; it cannot justify a broader clinical or causal claim.

PLTW-GEND-2026-09-24 · Simulated classroom evidence scenario

Your role: medical interventions team member

Decision: Your team must decide what the evidence from lab report submission supports before submitting the lab report named on the lesson page.

  • Choose the strongest supported explanation.
  • Choose the next evidence to collect.
  • Hold the decision because the evidence is insufficient.

Response: State one choice, cite at least two evidence IDs, explain the rule that connects them, and add one limitation. Submit it as the lab report.

Claim ceiling: The supplied lesson evidence can support an observation, pattern, classroom mechanism, or next-step decision about lab report submission. It cannot by itself prove causation, establish a real clinical diagnosis, or justify action outside this classroom task.

Composite case file · PLTW-GEND-2026-09-24

Reason for review: Your team must decide what the evidence from lab report submission supports before submitting the lab report named on the lesson page.

Context: Submit a full lab report interpreting your controls, results, and the test's reliability.

Timeline:
  • T1: Assemble your plate photo, color , and control results.
  • T2: Write a Claim about which samples were positive and a Reasoning paragraph using your data.
  • T3: Discuss the test's sensitivity and specificity based on your run.
  • T4: Add one sentence on a limitation or error in your procedure.
  • T5: Submit the report on the class site.
  • T6: Confirm it is turned in and note one improvement for next time.
Evidence records:
  • E1: A complete lab report integrates visual evidence (photo), quantitative data (table), and analytical interpretation into one coherent argument.
  • E2: How does a complete lab report turn raw data into a reliable scientific conclusion?
  • E3: You will be able to submit a complete lab report.

Measurements: Use only the measurements, units, graph, or counts supplied in today's task. No additional patient measurement is implied.

Figure finding: Teaching diagram for lab report submission. Trace the labeled testing, treatment, or biological process and identify where evidence limits the decision. This is a teaching model, not patient or experimental data.

Uncertainty: This is a composite classroom scenario. Missing history, measurements, or confirmation tests remain unknown and limit the conclusion.

Math moment
Formula or setup

For a linear , y = mx + b. To estimate an unknown concentration, use x = (y - b) / m.

Worked parallel example

A is y = 0.40x + 0.10. An unknown signal is 0.90. x = (0.90 - 0.10) / 0.40 = 2.0 concentration units.

Units and reasonableness

Signal units belong on y. Concentration units belong on x. Confirm the unknown falls inside the standards before interpreting it.

Try it with today's data

Use the equation or graph supplied today to estimate one unknown. Show the substitution, concentration unit, and range check.

Portal terms
CER:
Claim, Evidence, Reasoning: make a claim, back it with evidence, explain your reasoning.
SOP:
Standard Operating Procedure, the exact steps to follow (especially in a lab).
Tracker:
Your PLTW progress log where you record completed evidence.
myPLTW:
The PLTW course site where you do the online activities. Find it in Clever with your Microsoft sign-in, right next to Schoology.
This unit's vocabulary

Tap the speaker to hear a term. Add two of these to your notebook glossary with a definition and an example in your own words.

Build your vocabulary · optional, for extra credit

Pick just 2 or 3 words from today and make them yours: write what each one means in your own words, name the context clue or evidence that helped, then give one example from what you actually did in ELISA lab report submission. Try your own words first; the glossary is there if you get stuck. This is voluntary and counts as extra credit, so keep it short.

positive control
negative control
specificity
sensitivity
primary antibody
secondary antibody

Saved on this device. Show Mr. Mendoza or add these to your notebook glossary to claim the extra credit.

Teacher-posted resources

Classroom documents for this lesson are posted in Schoology. Open Clever, then Schoology, and find each one by the name shown on its card.

Use during lessonFor: Everyone
MI 1.1.5 ELISA
worksheet/handoutPosted in Schoology
Open in Schoology

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Catch-up / reteachFor: Need extra support
MI 1.1.5 ELISA Lab Results (Distance Learning)
worksheet/handoutPosted in Schoology
Open in Schoology

Use this if you were absent, got stuck, or need another pass before you submit the lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Use during lessonFor: Everyone
Activity 1.1.5 ELISA (Bio-Rad version)
worksheet/handoutPosted in Schoology
Open in Schoology

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

How to get there: open Clever and sign in with your Microsoft (district) account. Both myPLTW and Schoology are in Clever. Do the activity in myPLTW. Turn the work in on this site or hand it to Mr. Mendoza, because that is the step that counts as submitted. Schoology only shows your report-card grade later.

Check yourself · commit, then reveal

Claim ceiling for this check: The supplied lesson evidence can support an observation, pattern, classroom mechanism, or next-step decision about lab report submission. It cannot by itself prove causation, establish a real clinical diagnosis, or justify action outside this classroom task.

WebXam-style practice
Tap an answer to check it · nothing is recorded or graded
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
In an ELISA, what is added after the primary antibody binds the antigen so that a visible result can develop?
A diagnostic test gives a color change only when the target antigen is truly present and not when it is absent. This property is best described as the test's what?
An ELISA result is read simply as a color change with no number attached. This kind of observed, non-measurable result is called what?
Cumulative WebXam review · flash practice

Fast retrieval with instant answers, not the commit-then-reveal check above. Try each from memory first: write what you remember about the earlier units, then check yourself here.

Tap an answer to check it · nothing is recorded or graded
[Review: Framing an Outbreak Investigation] Which microbiology principle states that one specific organism causes a specific disease and can be isolated from a host who has that disease?
[Review: Who is the culprit? Identifying a pathogen with DNA and BLAST] What was the landmark international collaboration that identified the nucleotide base pairs of humans?
[Review: Getting ready to test: serial dilutions and the ELISA setup] A technician makes a serial dilution starting with 100 ng/mL of antigen, transferring equal parts antigen and water at each step. What is the concentration after the first two dilutions?
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
Go further and get help
Lab · prepare, conduct, complete
1Prepare
Pre-lab pass · clear all six to go to the bench
0/6

I can name the procedure's purpose and the evidence I will record. I can identify each named hazard and the control that reduces it: Wear the required PPE, keep the bench clear, handle equipment only as directed, and know where the eyewash, sink, and spill kit are before you start. My data table is ready before materials are handled.

Finish the checklist before you handle any material.

Bring / set up
Pre-coated ELISA microplatePrimary antibody solutionSecondary antibody solutionSubstrate solutionWash buffer and squirt bottleMicropipettes and tipsPositive and negative control samples
Safety · specific to today's hazards
  • Wear the required PPE, keep the bench clear, handle equipment only as directed, and know where the eyewash, sink, and spill kit are before you start.
  • Human samples and data stay private: label with a code, never a name, and dispose of materials in the correct waste container, then wash your hands.
Review Lab Safety (rules, PPE, SDS, emergencies) and check your contract + test
2Conduct (Argument-Driven Inquiry)
  1. 1Before materials are handled, identify the purpose, variables or comparison, controls, measurement units, and stop-work condition.
  2. 2Assemble your plate photo, color data table, and control results.
  3. 3Write a Claim about which samples were positive and a Reasoning paragraph using your data.
  4. 4Discuss the test's sensitivity and specificity based on your run.
  5. 5Add one sentence on a limitation or error in your procedure.
  6. 6Submit the report on the class site.
  7. 7Confirm it is turned in and note one improvement for next time.
  8. 8Record each result in the prepared table before interpreting it. Mark missing, repeated, or invalid results truthfully.
  9. 9Complete the named cleanup and waste route, remove PPE safely, wash hands when required, and confirm the station is ready for the next group.
Prepare this data table before materials are handled
Trial or sample IDIndependent conditionMeasured result with unitsObservation before interpretationQuality-control note
     
     
     
HHMI BioInteractive (preview; use fallback if blocked)
3Complete
Argue from your evidence, then compare what you predicted to what happened. Error analysis names a specific method limit, never "human error".
You predicted

Before the procedure, predict the result and cite the rule behind the prediction.

What actually happened

After the procedure, compare the result with the prediction and name one limitation or source of uncertainty.

Your lab report is graded on the rubric below, with extra weight on error analysis and method.
Where this leads: careers

What today's skills lead to. These are real health-science careers this course builds toward. Tap one to see, on the US Department of Labor's O*NET site, what the job actually involves, what it pays, and how fast it is growing.

What to do if you were absent
This one used the bench

The bench work needs equipment you do not have at home. Do the thinking half now: read the procedure, write your prediction, and set up your data table so it is ready.

Back in class. Ask Mr. Mendoza for the class data set, or for a bench slot to run it yourself. Do not submit a Lab report with invented numbers.

If MR. MENDOZA is absent

Class still runs. Complete the online activity above (it's self-guided). Need the concept taught without a teacher? Use this authoritative explainer:

HHMI BioInteractive (preview; use fallback if blocked)
How this is graded
For: Lab report: Full ELISA lab report: plate photo, data table, claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.
  • Complete
    Every required part of the artifact is present, nothing left blank.
  • Accurate
    The science and the data are correct and match the evidence.
  • Scientific reasoning
    You explain your claim with evidence and reasoning (CER), not just an answer.
  • Professional communication
    Clear, organized, labeled, and written the way a clinician or scientist would.
  • Submitted
    Turned in the right way, on the class site or handed to Mr. Mendoza in class, and confirmed. Not in Schoology: that is where the report-card grade appears later.
  • Error analysis and method · counts double
    Name a specific limit of the method and how it moved your result, and compare what you predicted to what happened. "Human error" does not count; say what about the procedure or instrument caused it.