Tue, Sep 22, 2026Fall (Semester 1) · Week 5Day 21 of 6780-min block

Wet ELISA lab

Today's target

Run a real ELISA with positive and negative controls and record the color result for each well.

Due today · Data table Required

Wet ELISA data table: well ID, reagent added, color result; control validation note; plate photograph.

Your 4 steps today
  1. 1
    Do this
    Run a real ELISA with positive and negative controls and record the color result for each well.
  2. 2
  3. 3
    Submit this
    Data table: Wet ELISA data table: well ID, reagent added, color result; control validation note; plate photograph.
  4. 4
    Submit it here
    1. 1CMSD website. Go to clevelandmetroschools.org and click the Clever button.
    2. 2Clever. Clever opens. Sign in if it asks.
    3. 3Microsoft (district) login. Use your district Microsoft account (the one for school).
    4. 4Schoology. Open Schoology, then your class, then Assignments, and find the file named below.
    The file to submit is named: Genetics of Disease (Medical Interventions) › Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. › Data table
    Open Schoology
Were you absent? Jump to the make-up plan
Where this fits
Tested on (Ohio WebXam)
Genetics of Disease · 072130
PLTW lesson
MI · Wet ELISA lab
WebXam domain
Bio-Molecular Technology
Evidence to produce
Data table
Lab / skill
HHMI BioInteractive
Quick glossary
CER:
Claim, Evidence, Reasoning — make a claim, back it with evidence, explain your reasoning.
SOP:
Standard Operating Procedure — the exact steps to follow (especially in a lab).
Tracker:
Your PLTW progress log where you record completed evidence.
myPLTW:
The PLTW course site where you do the online activities — you open it through Schoology.
Learn first

Minute-by-minute · 80-minute block

💡 Big idea: How does following a precise multi-step procedure with proper controls produce a result you can trust?

  1. 0-8 minDon goggles and gloves; confirm plate layout matches Tuesday's plan before opening any reagent
  2. 8-25 minAdd reagents to each well in the correct order per the numbered procedure; keep controls in their designated wells
  3. 25-45 minWait incubation period exactly as written; do not disturb the plate; record start time
  4. 45-58 minAdd detection reagent; observe and record color in every well as it develops
  5. 58-68 minPhotograph the plate next to the layout sheet; save image to portfolio folder
  6. 68-80 minNote whether controls matched predictions; write one sentence validating (or flagging) the run
Mr. Mendoza's 5-minute intro
  • This is the most technically demanding day of the unit; every step you practiced Tuesday exists to make this run succeed.
  • Real clinical ELISA runs in a hospital lab follow the same sequence you are about to use.
  • Work slowly and methodically; speed kills accuracy in wet lab work.
  • Exit goal: a complete data table and a photographed plate with both controls validated.
Do this, step by step
  1. 1Put on goggles and gloves and confirm your plate layout matches your plan.
  2. 2Add reagents to each well in the correct order, keeping controls separate.
  3. 3Wait the required incubation times exactly as written in the procedure.
  4. 4Add the detection reagent and record the color that develops in every well.
  5. 5Photograph the plate next to your layout sheet for your portfolio.
  6. 6Note whether your positive and negative controls matched your predictions.
You'll be able to
  • You will be able to run an ELISA following a procedure safely.
  • You will be able to record well colors accurately.
  • You will be able to check controls to validate a run.
Know by the end
  • ELISA steps must be performed in exact order; adding reagents out of sequence destroys the binding chain and invalidates results.
  • Incubation times are critical: too short and binding is incomplete; too long and background signal builds up.
  • Checking controls immediately after the run tells you whether to trust any of the other results.
📺 Tutor me: HHMI BioInteractive: immune system and antibody resources
Do the work

Your PLTW work today

Open this PLTW section today

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Wet ELISA lab

Day 3 of this lesson. Open this exact section in myPLTW (reached through Schoology), then do the work below.

Do this: Open Activity 1.1.5 ELISA (protocol and results) in myPLTW and follow the wet-lab protocol to run your ELISA today.

Complete

Record color results for every well and note whether your positive and negative controls matched predictions.

How far to get

Plate-layout plan should be done (Tuesday); well-color data recorded and photographed today.

Upload as evidence

Plate photo and color-result data table in notebook and portfolio folder.

All PLTW activities are completed inside the PLTW course environment — this page only gives direction. Submit producibles on Schoology.

The plan

Today's PLTW tracker

Check things off as you work, then submit. This tells Mr. Mendoza how you're doing so he can help the class. It does not replace turning in your producible on Schoology.

Use the code Mr. Mendoza gave you, not your name. Saved on this device.

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic.Day 3 of this projectSee the full week plan
Today's PLTW target

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Wet ELISA lab

Open Activity 1.1.5 ELISA (protocol and results) in myPLTW and follow the wet-lab protocol to run your ELISA today.

Plate-layout plan should be done (Tuesday); well-color data recorded and photographed today.

This is how Mr. Mendoza sees the class keeping pace with PLTW. Be honest, it only helps if it is accurate.

1 · What you do today

🎯 Run a real ELISA with positive and negative controls and record the color result for each well.

  • Put on goggles and gloves and confirm your plate layout matches your plan.
  • Add reagents to each well in the correct order, keeping controls separate.
  • Wait the required incubation times exactly as written in the procedure.
  • Add the detection reagent and record the color that develops in every well.
  • Photograph the plate next to your layout sheet for your portfolio.
  • Note whether your positive and negative controls matched your predictions.
2 · Turn in today

Data table: Wet ELISA data table: well ID, reagent added, color result; control validation note; plate photograph.

Submit on Schoology

Upload by 11:29 PM for full credit.

3 · Who's doing what (team)
TaskWho
Put on goggles and gloves and confirm your plate layout matches your plan._______
Add reagents to each well in the correct order, keeping controls separate._______
Wait the required incubation times exactly as written in the procedure._______
Add the detection reagent and record the color that develops in every well._______
Photograph the plate next to your layout sheet for your portfolio._______
Note whether your positive and negative controls matched your predictions._______

Working solo? Put your own name in "Who" for every row.

4 · Words I can use correctly
5 · I'm successful today when I can…
  • You will be able to run an ELISA following a procedure safely.
  • You will be able to record well colors accurately.
  • You will be able to check controls to validate a run.
6 · Reflection & next steps
Where are you today?0/9 checked
Pick your period and code first.
Explore

Teacher-posted resources

Classroom documents for this lesson. Ones marked “Open the file” open right here; the rest are posted in Schoology. Use the label on each card to choose the right move.

Use during lessonFor: Everyone
MI 1.1.5 ELISA
worksheet/handoutOpens here
Open the file

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Catch-up / reteachFor: Need extra support
MI 1.1.5 ELISA Lab Results (Distance Learning)
worksheet/handoutOpens here
Open the file

Use this if you were absent, got stuck, or need another pass before you submit the lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Use during lessonFor: Everyone
Activity 1.1.5 ELISA (Bio-Rad version)
worksheet/handoutOpens here
Open the file

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

How to get there: open the CMSD website, click Clever, sign in with your Microsoft (district) account, then open Schoology from Clever.

Lab day

Lab & supplies

Bring / set up
ELISA kit (microwell plate, antigen samples, primary antibody, secondary enzyme-linked antibody, substrate, stop solution)Micropipettes and tips (calibrated; one set per lab group)Timer (one per group)Nitrile gloves (at least one pair per student)Safety goggles (one per student)Plate layout diagram from Tuesday (printed or in notebook)Camera or phone for plate photographWaste container for used tips and reagentsDisinfectant or 10% bleach solution for cleanup
Safety / SOP
  • Goggles and gloves are mandatory before any reagent is opened and must stay on until cleanup is complete.
  • Treat all samples as potentially biohazardous: use disposable tips and do not pipette by mouth.
  • Dispose of used tips, plate, and reagents in the designated biohazard waste container.
  • Add stop solution in a fume hood or well-ventilated area if required by the reagent SDS.
  • Spills on skin: rinse immediately with water for 15 minutes; report to teacher; reference the reagent SDS for Section 4.
  • Do not eat, drink, or touch your face in the lab area.
HHMI BioInteractive
Words

This unit's vocabulary

positive controlnegative controlspecificitysensitivityprimary antibodysecondary antibody

Tap the speaker to hear a term. Weekly vocabulary task: add two of these terms to your notebook glossary with a definition and an example in your own words.

Check yourself

WebXam practice

Tap an answer to check it · nothing is recorded or graded
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
In an ELISA, what is added after the primary antibody binds the antigen so that a visible result can develop?
A diagnostic test gives a color change only when the target antigen is truly present and not when it is absent. This property is best described as the test's what?
An ELISA result is read simply as a color change with no number attached. This kind of observed, non-measurable result is called what?
Check yourself

Cumulative WebXam review

A quick mixed-review pulling questions from earlier units plus today, so the WebXam material stays fresh.

Tap an answer to check it · nothing is recorded or graded
[Review: Framing an Outbreak Investigation] Which microbiology principle states that one specific organism causes a specific disease and can be isolated from a host who has that disease?
[Review: Who is the culprit? Identifying a pathogen with DNA and BLAST] What was the landmark international collaboration that identified the nucleotide base pairs of humans?
[Review: Getting ready to test: serial dilutions and the ELISA setup] A technician makes a serial dilution starting with 100 ng/mL of antigen, transferring equal parts antigen and water at each step. What is the concentration after the first two dilutions?
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
Explore

Where this leads — careers

What today's skills lead to. These are real health-science careers this course builds toward. Tap one to see, on the US Department of Labor's O*NET site, what the job actually involves, what it pays, and how fast it is growing.

Safety net

What to do if you were absent

Today was a lab — do this instead

If you miss the wet lab, complete a virtual ELISA simulation and interpret the teacher color dataset, then submit which samples were positive and how your controls validated the run.

learn.genetics (Utah) virtual labs

Then submit your Data table on Schoology.

If MR. MENDOZA is absent

Class still runs. Complete the online activity above (it's self-guided). Need the concept taught without a teacher? Use this authoritative explainer:

HHMI BioInteractive
How this is graded
For: Data table — Wet ELISA data table: well ID, reagent added, color result; control validation note; plate photograph.
  • Complete
    Every required part of the artifact is present, nothing left blank.
  • Accurate
    The science and the data are correct and match the evidence.
  • Scientific reasoning
    You explain your claim with evidence and reasoning (CER), not just an answer.
  • Professional communication
    Clear, organized, labeled, and written the way a clinician or scientist would.
  • Submitted
    Turned in the right way (Schoology for routine work) and confirmed.
Submission Zone

Drop your Tue, Sep 22, 2026 · Wet ELISA lab here. Use a clear file name (your initials + project). Routine work still goes to Schoology (via the CMSD portal).

Upload a project