Mon, Sep 21, 2026Fall (Semester 1) · Week 5Day 20 of 7780-min blockCalendar fit

Bioethics debate: false results

Essential question: When a medical test can be wrong in two different directions, how do we decide it is still ethical to use?Enduring understanding: No diagnostic test is perfect, so ethical use depends on weighing which kind of error does more harm in a specific clinical situation, not on demanding a test that never misses.

Do now

Debate the ethics of using a diagnostic test that sometimes gives false positives or false negatives.

DueTonight, 11:29 PM
Hand in
Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.
Where
Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not.

You get two school days for every day you were absent, so this deadline moves with you.

Where you are · this course
Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. Bioethics debate: false results ▸ Day 1
Day 20 of 77 this semester57 left before WebXam
🧬 Where you are · PLTW
Medical InterventionsUnit 1: How to Fight Infection ▸ Lesson 1.1 The Mystery Infection"Activity 1.1.5 ELISA", "Activity 1.1.6 Final Diagnosis"
Matched to your live myPLTW course (verified June 2026).
Today's driving question

A cheap, fast test sometimes tells a healthy person they are sick and sometimes tells a sick person they are healthy. Should a clinic use it, and under what conditions?

Today you'll be able to

Debate the ethics of using a diagnostic test that sometimes gives false positives or false negatives.

You've got it when
  • You will be able to argue when an imperfect test is ethical to use.
  • You will be able to compare the harms of false positives and false negatives.
  • You will be able to rebut an opposing view.
Due today · CER RequiredWritten CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.
Do-Now · start these with your notes closed
  1. In your own words, which is worse for a patient: being told they are sick when they are healthy, or being told they are healthy when they are sick? Explain why your answer depends on the disease.
  2. Name one real situation where you would rather a test flag too many people than miss anyone.
Do this · step by step
numbered so we can always find our place
  1. 1Read the scenario: a test is fast and cheap but occasionally wrong in both directions.
  2. 2Write your Claim: is it ethical to use this test, and under what conditions?
  3. 3Add a Reason that weighs the harm of a against a .
  4. 4Find a partner with a different view and note their strongest point.
  5. 5Write a Rebuttal that addresses it.
  6. 6Post your CER and read how two classmates handled the false-result tradeoff.
Interrupted or lost? Lost your place? You should have a written Claim (is the test ethical, and when) plus a Reason. If you have those, go find a partner with a different view and note their strongest point, then write your Rebuttal and post your CER.
Optional project open: 072130 Molecular Lab Review - solo or group, about 1.5 to 2 hours total. Due by Fri, Jan 15, 2027. Great WebXam prep.
The story

What did this day actually feel like?

Bioethics: false results

ETHICS MONDAY A false negative tells a sick person they are fine. A false positive tells a healthy person they are sick. Which error should a test be designed to avoid?

It depends entirely on what happens next. If the follow-up is a cheap confirmatory test, lean toward catching everything. If it is surgery, do not. The right answer is a property of the whole system, not the test.

AT HOME, THE NIGHT BEFORE TUE SEP 22 Controls and wet-lab plan Positive control, negative control, blank. If the negative control comes up positive, every result on that plate is meaningless.

Planning the plate layout in advance, well by well, is most of the work.

Turned in: pre-lab → recorded in Class Records

Fiction. There is no such student. The lessons, labs and dates are the real planned course; the student, the classmates and the conversations are invented.

The comic

The same day, drawn.

Drawing, panel 25: Bioethics debate: false results.

False results. A false negative sends someone home contagious. A false positive treats someone who is well. You cannot eliminate both.

Panel 25Bioethics debate: false results · 2026-09-21
Read week 6, 5 panels

Fiction. There is no such student. The lessons, labs and dates are the real planned course; the student, the classmates and the conversations are invented.

🛠 Get unstuck · pick your level

Need a running start
Before the debate, make sure you can say the difference between a false positive and a false negative out loud, using the HIV-test example, so you can argue about them instead of defining them mid-argument.
On track
Build a full CER: take a clear position on when the imperfect test is ethical, back it with a reason that weighs one error type against the other, and rebut a classmate's opposing point.
Stuck? Get unstuck
If you are stuck on your Reason, pick one disease (say, flu versus HIV) and finish this sentence: 'For this disease, a false ______ is worse because ______.' That sentence is your Reason.
Push me further
Argue the harder case: give a real scenario where high sensitivity is unethical because the false positives cause more damage than the disease being screened, such as mass screening for a rare cancer.

🔑 Today's words · 5

positive controlnegative controlspecificitysensitivityprimary antibody
+1 more in the word bank

Tap a word in the lesson for a plain meaning and one example. Recycled into next week's Do-Now.

Today's study notebook
Serial dilution, antibodies, and the ELISA test for detecting a target in a sample.
Open the notebook
Watch first: today's 1-minute intro
Audio overviewVideo overviewMind mapStudy guideFlashcardsQuizData table
CER · ArgumentThinking like a scientist · Part 4 of 4

Argument: disagreeing well, and when opinion becomes fact

How do we argue productively when we disagree, and when does a claim become accepted as fact?

An argument is not a fight. It is two or more people testing claims against evidence to get closer to the truth. The best disagreements aim at the strongest version of the other side (steelman it), refute the actual reasoning, and stay about the idea, not the person.

A sound argument and a clash of opinions are different things. Opinions can simply differ and both stand. A scientific argument is settled by evidence: the side with stronger, more reliable evidence and better reasoning should win, and everyone should be willing to update.

So when does an opinion become a fact? In science, a claim becomes accepted not because enough people like it, but when independent evidence keeps supporting it and repeated attempts to disprove it fail. That is consensus, and it is provisional: it holds until better evidence changes it. Truth is not a vote, but agreement among many careful, independent investigations is the best signal we have.

A good argument
  • Steelmans: it takes on the strongest version of the other side.
  • Targets reasoning and evidence, never the person.
  • Is settled by evidence, not by who is louder or more popular.
  • Stays open: the participants will change their minds if the evidence does.
Opinion vs. established fact
  • A claim earns the label “fact” through repeated, independent evidence, not a popularity vote.
  • Even strong consensus stays open to revision if better evidence appears.
Do this today

Take a claim from this course that people might dispute. Write the strongest argument for it and the strongest against it, then say which the evidence supports and what would change your mind.

Where this fits
Tested on (Ohio WebXam)
Genetics of Disease · 072130
PLTW lesson
MI · Lesson 1.1 The Mystery Infection
WebXam domain
Bio-Molecular Technology
Evidence to produce
CER
Lab / skill
HHMI BioInteractive (preview; use fallback if blocked)
Do the work · 80-minute blockfirst 5 min = hook

💡 Big idea: Every diagnostic test trades false positives against false negatives, so the ethical choice is not a perfect test but the error the clinical context can most afford.

  1. 0-10 minRead scenario; define and in notebook with a clinical example each
  2. 10-25 minDraft CER: claim (ethical or not, under what conditions), reason, evidence from the scenario
  3. 25-40 minPartner exchange: find someone with a different view; record their strongest point
  4. 40-55 minWrite rebuttal; revise claim if the counterpoint exposed a gap in reasoning
  5. 55-68 minPost CER to the discussion board
  6. 68-80 minRead two classmates' CERs; leave a one-sentence response to each
Mr. Mendoza's 5-minute intro
  • No medical test is perfect; the question is never 'is this test perfect?' but 'are the errors this test makes acceptable given what's at stake?'
  • False negatives for HIV versus false positives for a low-risk condition carry very different ethical weights.
  • This debate connects directly to the specificity and sensitivity analysis you will do Thursday after running your real .
  • Exit goal: a posted CER arguing for or against using an imperfect test, with a rebuttal addressing the opposing view.
Know by the end
  • A tells a healthy person they are sick; a tells a sick person they are healthy; the harms of each differ by context.
  • Sensitivity and specificity are the technical measures of a test's accuracy: they can be traded off against each other by adjusting the threshold.
  • Ethical use of an imperfect test depends on the consequences of each type of error in the specific clinical context.
Open this PLTW section today

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Bioethics debate: false results

Day 1 of this lesson. Open this exact section in myPLTW (find it in Clever, Microsoft sign-in), then do the work below.

Do this: Open the false-results bioethics discussion activity in myPLTW for Lesson 1.1 The Mystery Infection and review the CER rubric.

Complete

Post your CER on using an imperfect test and reply to at least two classmates.

How far to get

pre-lab packet should be submitted; this debate opens the wet-lab week.

Upload as evidence

CER post visible in the course discussion board.

The official PLTW activity stays inside myPLTW. If myPLTW will not open, use F1 and E1-E3 on this page to complete today's local evidence decision, then make up the official activity when access returns. Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not.

Today's PLTW tracker · fill in and submit

Check things off as you work, then submit. This tells Mr. Mendoza how you're doing so he can help the class. It does not replace turning in your producible through the submission route shown below.

Use the code Mr. Mendoza gave you, not your name. Saved on this device.

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic.Day 1 of this projectSee the full week plan
Today's PLTW target

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Bioethics debate: false results

Open the false-results bioethics discussion activity in myPLTW for Lesson 1.1 The Mystery Infection and review the CER rubric.

pre-lab packet should be submitted; this debate opens the wet-lab week.

This is how Mr. Mendoza sees the class keeping pace with PLTW. Be honest, it only helps if it is accurate.

1 · What you do today

🎯 Debate the ethics of using a diagnostic test that sometimes gives false positives or false negatives.

  • Read the scenario: a test is fast and cheap but occasionally wrong in both directions.
  • Write your Claim: is it ethical to use this test, and under what conditions?
  • Add a Reason that weighs the harm of a against a .
  • Find a partner with a different view and note their strongest point.
  • Write a Rebuttal that addresses it.
  • Post your CER and read how two classmates handled the false-result tradeoff.
2 · What you turn in

CER: Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.

Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not. Use the checklist just below and upload by 11:29 PM for full credit. Absent with an excused absence? You get two school days for every day you were absent, so this deadline moves with you.

3 · Who's doing what (team)
TaskWho
Read the scenario: a test is fast and cheap but occasionally wrong in both directions._______
Write your Claim: is it ethical to use this test, and under what conditions?_______
Add a Reason that weighs the harm of a against a ._______
Find a partner with a different view and note their strongest point._______
Write a Rebuttal that addresses it._______
Post your CER and read how two classmates handled the false-result tradeoff._______

Working solo? Put your own name in "Who" for every row.

4 · Words I can use correctly
5 · I'm successful today when I can…
  • You will be able to argue when an imperfect test is ethical to use.
  • You will be able to compare the harms of false positives and false negatives.
  • You will be able to rebut an opposing view.
6 · Reflection & next steps
Where are you today?0/9 checked
Pick your period and code first.
Your 4 steps today
  1. 1
    Do this
    Debate the ethics of using a diagnostic test that sometimes gives false positives or false negatives.
  2. 2
  3. 3
    Submit this
    CER: Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.
  4. 4
    Submit it here
    1. 1Open the drop folder.
    2. 2Sign in with your district Microsoft account, not a personal one.
    3. 3Upload the file, named Lastname_Firstname__Assignment Title.
    4. 4Your own upload panel says Uploaded with a green check: that is your receipt.
    Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not. Genetics of Disease (Medical Interventions) › Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. › CER
    Open the drop folder
Were you absent? Jump to the make-up plan
Learn it · deck, reading, and vocabulary
Socratic teaching slide deck

The deck carries the prior idea forward, lets you inspect an analogy, maps the rule to biology, and ends with the same evidence decision and exit ticket used on this page.

Generated from this lesson's canonical data with a red-team citation check.

Carry forward

A result travels with its graph, data, and interpretation and openly names its error, so that another scientist can replicate it and know exactly how far to trust it.

Daily take-home

Every diagnostic test trades false positives against false negatives, so the ethical choice is not a perfect test but the error the clinical context can most afford.

Inspect the analogy

A smoke alarm detects signs of fire but can also react to burnt toast.

  1. What does the alarm detect?
  2. What creates a false alarm?
  3. What evidence is needed before declaring a fire?
Rule

A screening signal changes what to investigate next; it does not automatically prove the cause.

Where it breaks

Biomedical tests have measured performance and biological sampling limits that a household alarm does not capture.

Map the analogy to biology
  • Alarm signal maps to a test result.
  • Burnt toast maps to a .
  • Inspection maps to confirmation or the next test.
Read this first

Driving question: A cheap, fast test sometimes tells a healthy person they are sick and sometimes tells a sick person they are healthy. Should a clinic use it, and under what conditions?

What you already know: A result travels with its graph, data, and interpretation and openly names its error, so that another scientist can replicate it and know exactly how far to trust it.

New idea: Every diagnostic test trades false positives against false negatives, so the ethical choice is not a perfect test but the error the clinical context can most afford.

Visual or model: F1. F1. A lesson illustration or teaching diagram for Bioethics debate: false results. Use it with E1-E3; it is a model or context image, not experimental or patient data. What to notice: Trace the labeled testing, treatment, or biological process and identify where evidence limits the decision.

  1. Observe or measure the relevant feature in Bioethics debate: false results.
  2. Organize the observation with a stable evidence ID.
  3. Apply this rule: A screening signal changes what to investigate next; it does not automatically prove the cause.
  4. Choose the option the evidence supports and state the limit of the conclusion.

Real biomedical example: A cheap, fast test sometimes tells a healthy person they are sick and sometimes tells a sick person they are healthy. Should a clinic use it, and under what conditions?

What the evidence supports: E1-E3 and F1 support the daily take-home when the response meets the stated success criteria.

What it cannot prove: The package does not support claims beyond this lesson's or any real patient diagnosis.

Vocabulary:
  • : A sample known to produce a result, included in an experiment to confirm that the test is working correctly.
  • : A sample in an experiment expected to show no effect, used as a baseline to confirm that any result in the test sample is real.
  • specificity: A test's ability to correctly identify people who do not have a condition, giving few false positives.
  • sensitivity: A test's ability to correctly identify people who truly have a disease, measured as the share of real cases that the test flags as positive.
  • : The first added in a test that binds directly to the target molecule, marking it so it can be detected later.
  • : An that binds to a and carries a tag, such as a dye or , to make the target visible in a test.

Use it now: Choose one decision option. Cite E1 and E3, then explain how the rule connects the evidence to your choice.

Go further, optional: The source links below are optional enrichment. Every fact required for today's local evidence decision appears in this lesson package.

Evidence set and decision
E1 · Observation

A tells a healthy person they are sick; a tells a sick person they are healthy; the harms of each differ by context.

Limit: E1 supplies context or an observation; it does not by itself establish the explanation.

E2 · Mechanism

Every diagnostic test trades false positives against false negatives, so the ethical choice is not a perfect test but the error the clinical context can most afford.

Limit: E2 is a teaching statement or comparison and must be checked against the task evidence.

E3 · Result

You will be able to argue when an imperfect test is ethical to use.

Limit: E3 supports only the result or product criterion named here; it cannot justify a broader clinical or causal claim.

PLTW-GEND-2026-09-21 · Simulated classroom evidence scenario

Your role: medical interventions team member

Decision: Your team must decide what the evidence from Bioethics debate: false results supports before submitting the claim-evidence-reasoning response named on the lesson page.

  • Choose the strongest supported explanation.
  • Choose the next evidence to collect.
  • Hold the decision because the evidence is insufficient.

Response: State one choice, cite at least two evidence IDs, explain the rule that connects them, and add one limitation. Submit it as the claim-evidence-reasoning response.

Claim ceiling: The supplied lesson evidence can support an observation, pattern, classroom mechanism, or next-step decision about Bioethics debate: false results. It cannot by itself prove causation, establish a real clinical diagnosis, or justify action outside this classroom task.

Composite case file · PLTW-GEND-2026-09-21

Reason for review: Your team must decide what the evidence from Bioethics debate: false results supports before submitting the claim-evidence-reasoning response named on the lesson page.

Context: No diagnostic test is perfect, so ethical use depends on weighing which kind of error does more harm in a specific clinical situation, not on demanding a test that never misses.

Timeline:
  • T1: Read the scenario: a test is fast and cheap but occasionally wrong in both directions.
  • T2: Write your Claim: is it ethical to use this test, and under what conditions?
  • T3: Add a Reason that weighs the harm of a against a .
  • T4: Find a partner with a different view and note their strongest point.
  • T5: Write a Rebuttal that addresses it.
  • T6: Post your CER and read how two classmates handled the false-result tradeoff.
Evidence records:
  • E1: A tells a healthy person they are sick; a tells a sick person they are healthy; the harms of each differ by context.
  • E2: Every diagnostic test trades false positives against false negatives, so the ethical choice is not a perfect test but the error the clinical context can most afford.
  • E3: You will be able to argue when an imperfect test is ethical to use.

Measurements: Use only the measurements, units, graph, or counts supplied in today's task. No additional patient measurement is implied.

Figure finding: Teaching diagram for Bioethics debate: false results. Trace the labeled testing, treatment, or biological process and identify where evidence limits the decision. This is a teaching model, not patient or experimental data.

Uncertainty: This is a composite classroom scenario. Missing history, measurements, or confirmation tests remain unknown and limit the conclusion.

Math moment
Formula or setup

Mean = sum of values / number of values. Median = middle ordered value. Range = maximum - minimum.

Worked parallel example

For 2, 4, 4, and 10: mean = 20 / 4 = 5, median = 4, and range = 10 - 2 = 8.

Units and reasonableness

Mean, median, and range keep the measurement unit. Order the values before finding the median.

Try it with today's data

Calculate the requested summary for today's supplied values, then write what it reveals and what it hides.

Watch the trap

Students often think Students assume a good test is one that is simply accurate, and that a false result means the lab made a mistake.. The trap: False positives and false negatives are not lab mistakes; they are built into every test because sensitivity and specificity trade off against each other, so pushing a test to catch every sick person will always flag more healthy people by accident.

Worked example · a parallel case (guides, does not reveal)
Worked CER on a parallel case
Completes: A parallel worked claim-evidence-reasoning argument, on whether a cheap smoke-and-carbon-monoxide alarm that sometimes false-alarms and sometimes stays silent is ethical to require, with conditions and a rebuttal, modeling the CER format without answering today's own prompt.

Note: This is a parallel model on a different scenario. It shows the shape of a strong claim-evidence-reasoning argument so you can build your own. It does not answer today's question about the diagnostic test.\n\nClaim: A cheap home alarm that sometimes sounds when there is no danger and sometimes fails to sound during a real hazard is still ethical to require in apartments, as long as it is paired with regular testing and clear instructions for what to do when it goes off.\n\nEvidence: A false alarm wakes a family for burnt toast, causing annoyance and, over time, a temptation to disable the unit. A missed alarm is far more serious, because carbon monoxide has no smell and a silent detector can let a family sleep through a deadly buildup. Manufacturers can shift this balance by changing the sensor's trigger level, trading fewer nuisance alarms for a higher chance of a missed one, or the reverse. Cheaper units test at lower accuracy than professional systems, but they still catch most real hazards.\n\nReasoning: The two errors do not carry equal weight. A false alarm costs minutes of sleep, while a missed alarm can cost a life, so a detector tuned to be sensitive protects against the worst outcome. Requiring an affordable unit means most homes have some protection instead of none, and the annoyance of occasional false alarms is a reasonable price for that coverage. Testing the unit monthly and teaching residents to evacuate rather than ignore it addresses the weaknesses without removing the protection.\n\nRebuttal: Some argue that an unreliable alarm should not be required, because a family that trusts a faulty unit may feel safe when they are not. But the alternative, requiring no alarm at all, leaves every home fully exposed. The answer is to keep the requirement and add habits that cover its blind spots, such as scheduled testing and a backup plug-in unit, not to abandon the safeguard because it is imperfect.

Why this matters

This model shows the level of evidence and organization needed to complete: A parallel worked claim-evidence-reasoning argument, on whether a cheap smoke-and-carbon-monoxide alarm that sometimes false-alarms and sometimes stays silent is ethical to require, with conditions and a rebuttal, modeling the CER format without answering today's own prompt.

Build yours step by step
  1. Write one defensible claim.
  2. Choose specific evidence that supports the claim.
  3. Explain the scientific rule that connects the evidence to the claim.
Change it for a new task

Keep the structure. Replace the question, facts, measurements, and evidence. Then recheck units, vocabulary, and whether the conclusion goes beyond the evidence.

Also due today: Post to the discussion board and read two classmates' positions.

See the full worked example
Portal terms
CER:
Claim, Evidence, Reasoning: make a claim, back it with evidence, explain your reasoning.
SOP:
Standard Operating Procedure, the exact steps to follow (especially in a lab).
Tracker:
Your PLTW progress log where you record completed evidence.
myPLTW:
The PLTW course site where you do the online activities. Find it in Clever with your Microsoft sign-in, right next to Schoology.
This unit's vocabulary

Tap the speaker to hear a term. Add two of these to your notebook glossary with a definition and an example in your own words.

Build your vocabulary · optional, for extra credit

Pick just 2 or 3 words from today and make them yours: write what each one means in your own words, name the context clue or evidence that helped, then give one example from what you actually did in Bioethics debate: false results. Try your own words first; the glossary is there if you get stuck. This is voluntary and counts as extra credit, so keep it short.

positive control
negative control
specificity
sensitivity
primary antibody
secondary antibody

Saved on this device. Show Mr. Mendoza or add these to your notebook glossary to claim the extra credit.

Teacher-posted resources

Classroom documents for this lesson are posted in Schoology. Open Clever, then Schoology, and find each one by the name shown on its card.

Use during lessonFor: Everyone
MI 1.1.5 ELISA
worksheet/handoutPosted in Schoology
Open in Schoology

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Catch-up / reteachFor: Need extra support
MI 1.1.5 ELISA Lab Results (Distance Learning)
worksheet/handoutPosted in Schoology
Open in Schoology

Use this if you were absent, got stuck, or need another pass before you submit the lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Use during lessonFor: Everyone
Activity 1.1.5 ELISA (Bio-Rad version)
worksheet/handoutPosted in Schoology
Open in Schoology

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

How to get there: open Clever and sign in with your Microsoft (district) account. Both myPLTW and Schoology are in Clever. Do the activity in myPLTW. Turn the work in on this site or hand it to Mr. Mendoza, because that is the step that counts as submitted. Schoology only shows your report-card grade later.

Check yourself · commit, then reveal

Claim ceiling for this check: The supplied lesson evidence can support an observation, pattern, classroom mechanism, or next-step decision about Bioethics debate: false results. It cannot by itself prove causation, establish a real clinical diagnosis, or justify action outside this classroom task.

Quick self-check · commit, then reveal

A clinic screens 10,000 people for a rare disease with a test that is 98 percent specific. Roughly how many healthy people will be told they might be sick, and does that make the test unethical to use?

How sure are you?

Write an answer and pick a confidence to unlock the key.

Cumulative WebXam review · flash practice

Fast retrieval with instant answers, not the commit-then-reveal check above. Try each from memory first: write what you remember about the earlier units, then check yourself here.

Tap an answer to check it · nothing is recorded or graded
[Review: Framing an Outbreak Investigation] Which microbiology principle states that one specific organism causes a specific disease and can be isolated from a host who has that disease?
[Review: Who is the culprit? Identifying a pathogen with DNA and BLAST] What was the landmark international collaboration that identified the nucleotide base pairs of humans?
[Review: Getting ready to test: serial dilutions and the ELISA setup] A technician makes a serial dilution starting with 100 ng/mL of antigen, transferring equal parts antigen and water at each step. What is the concentration after the first two dilutions?
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
Go further and get help
Where this leads: careers

What today's skills lead to. These are real health-science careers this course builds toward. Tap one to see, on the US Department of Labor's O*NET site, what the job actually involves, what it pays, and how fast it is growing.

What to do if you were absent
Today was a debate: do this instead

If you are away, post a full CER on whether an imperfect test should be used and reply to one classmate with a rebuttal.

Then submit your CER. Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not.

If MR. MENDOZA is absent

Class still runs. Complete the online activity above (it's self-guided). Need the concept taught without a teacher? Use this authoritative explainer:

HHMI BioInteractive (preview; use fallback if blocked)
How this is graded
For: CER: Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.
  • Complete
    Every required part of the artifact is present, nothing left blank.
  • Accurate
    The science and the data are correct and match the evidence.
  • Scientific reasoning
    You explain your claim with evidence and reasoning (CER), not just an answer.
  • Professional communication
    Clear, organized, labeled, and written the way a clinician or scientist would.
  • Submitted
    Turned in the right way, on the class site or handed to Mr. Mendoza in class, and confirmed. Not in Schoology: that is where the report-card grade appears later.