Semester 1 (Fall) · Week 6 of 18 teaching weeksSep 21–24

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic.

Your PLTW coursework: Medical InterventionsUnit 1: How to Fight Infection ▸ Lesson 1.1 The Mystery Infection ▸ "Activity 1.1.5 ELISA", "Activity 1.1.6 Final Diagnosis"

What to do if absent
Color keyLearn firstGet orientedDo the workLab daySafety netCheck yourself
Portal terms
CER:
Claim, Evidence, Reasoning: make a claim, back it with evidence, explain your reasoning.
SOP:
Standard Operating Procedure, the exact steps to follow (especially in a lab).
Tracker:
Your PLTW progress log where you record completed evidence.
myPLTW:
The PLTW course site where you do the online activities. Find it in Clever with your Microsoft sign-in, right next to Schoology.
Learn first

Week overview - Reading the color: running an ELISA and trusting your controls

Sep 21–24

Run an , read qualitative and quantitative color results, and use positive and negative controls to judge validity.

Week arc
  1. 1Set up your plate with your samples plus a and a well.
  2. 2Add , then , washing between steps as the protocol directs.
  3. 3Add and watch for color change, timing it the same for every well.
  4. 4Record each well as positive or negative (qualitative) and note color intensity (quantitative).
  5. 5Check that your turned color and your stayed clear before trusting results.
  6. 6Flag any well that could be a or and explain why.
By week end
  • You will be able to run an and read its color results.
  • You will be able to use controls to decide whether a run is valid.
  • You will be able to explain and risk.
The plan

Daily lessons this week

Open any day for its full lesson, the work due that day, and guided notes.

MondayMon, Sep 21
Bioethics debate: false results

Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.

TuesdayTue, Sep 22
Controls and wet-lab plan

Numbered wet procedure, labeled plate layout with positive and negative controls marked, and predicted control colors.

WednesdayWed, Sep 23
Wet ELISA lab

Wet : well ID, reagent added, color result; control validation note; plate photograph.

ThursdayThu, Sep 24
Specificity vs sensitivity

2x2 classification table sorting results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.

Friday
ELISA lab report submission

Full lab report: plate photo, , claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.

Get oriented

Quick intro to the week

  • Hook: a single mislabeled or contaminated well can flip a patient's diagnosis, so controls matter.
  • Today's goal: run the , read color, and let your controls tell you whether to trust the data.
  • Connect to Monday's debate on test reliability: sensitivity and specificity are exactly today's stakes.
  • Reminder: your color- and control analysis are graded in the PLTW course shell.
Do the work

Your PLTW coursework this week

Do this: Advance the PLTW Unit 1 diagnostic-lab benchmark in the online course shell with your results and control check.

Know when done
  • A should produce signal and a should not.
  • Sensitivity and specificity describe how well a test catches true cases and avoids false alarms.
Be able to do
  • Read results both qualitatively and quantitatively.
  • Use control wells to validate or reject a test run.

📋 PLTW tracker evidence due this week: color- with a written control validity check.

All PLTW activities are completed inside the PLTW course environment: this page only gives direction.

The plan

This week's PLTW tracker

Your week at a glance. Check off each deliverable as you finish it, then submit so Mr. Mendoza can see how the class is pacing.

Use the code Mr. Mendoza gave you, not your name. Saved on this device.

DayDateFocusKey deliverable
MondayMon, Sep 21Bioethics debate: false results Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.
TuesdayTue, Sep 22Controls and wet-lab plan Numbered wet ELISA procedure, labeled plate layout with positive and negative controls marked, and predicted control colors.
WednesdayWed, Sep 23Wet ELISA lab Wet ELISA data table: well ID, reagent added, color result; control validation note; plate photograph.
ThursdayThu, Sep 24Specificity vs sensitivity 2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.
Friday-ELISA lab report submissionFull ELISA lab report: plate photo, data table, claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.
Check off as you finish
  • M: debate + plate map
  • T: lab setup
  • W: ELISA data
  • Th: analysis
  • F: lab report submit

Due by week's end: ELISA lab report with controls, diagnosis, limitations.

Where are you this week?0/5 checked
Pick your period and code first.
The week, drawn

5 panels from the illustrated semester.

Fiction. There is no such student. The lessons, labs and dates are the real planned course; the student, the classmates and the conversations are invented.

Lab day

Lab day: what to bring & watch

Equipment you'll need
Pre-coated ELISA microplatePrimary antibody solutionSecondary antibody solutionSubstrate solutionWash buffer and squirt bottleMicropipettes and tipsPositive and negative control samples
HHMI BioInteractive (preview; use fallback if blocked)

This explainer accompanies the PLTW lab protocol: watch it before lab.

Safety net

What to do when absent

If YOU are absent

Most days, this class is your PLTW coursework: and PLTW is online and individual. So being out usually just means doing exactly what we did in class, from home.

Open Clever, then myPLTW

How to get there: open Clever and sign in with your Microsoft (district) account. Both myPLTW and Schoology are in Clever. Do the activity in myPLTW. Turn the work in on this site or hand it to Mr. Mendoza, because that is the step that counts as submitted. Schoology only shows your report-card grade later.

Was today a lab or a group activity?

You can't do those from home: do this instead: Virtual plus teacher color-data analysis.

If MR. MENDOZA is absent

Class still runs. A substitute will post today's plan: complete the online activity above; it's built to be self-guided. Need the concept taught without a teacher? Use this authoritative explainer:

HHMI BioInteractive (preview; use fallback if blocked)
Words

Vocabulary

positive controlnegative controlspecificitysensitivityprimary antibodysecondary antibody
Explore

Teacher-posted resources

Classroom documents for this lesson are posted in Schoology. Open Clever, then Schoology, and find each one by the name shown on its card.

Use during lessonFor: Everyone
MI 1.1.5 ELISA
worksheet/handoutPosted in Schoology
Open in Schoology

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Catch-up / reteachFor: Need extra support
MI 1.1.5 ELISA Lab Results (Distance Learning)
worksheet/handoutPosted in Schoology
Open in Schoology

Use this if you were absent, got stuck, or need another pass before you submit the lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Use during lessonFor: Everyone
Activity 1.1.5 ELISA (Bio-Rad version)
worksheet/handoutPosted in Schoology
Open in Schoology

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

How to get there: open Clever and sign in with your Microsoft (district) account. Both myPLTW and Schoology are in Clever. Do the activity in myPLTW. Turn the work in on this site or hand it to Mr. Mendoza, because that is the step that counts as submitted. Schoology only shows your report-card grade later.

Aligned to

Standards this week

Genetics of Disease 072130 · 5.5 Laboratory SOPs
Genetics of Disease 072130 · 5.8 Biotechnology Research and Experiments
Check yourself

WebXam practice

Tap an answer to check it · nothing is recorded or graded
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
In an ELISA, what is added after the primary antibody binds the antigen so that a visible result can develop?
A diagnostic test gives a color change only when the target antigen is truly present and not when it is absent. This property is best described as the test's what?
An ELISA result is read simply as a color change with no number attached. This kind of observed, non-measurable result is called what?