Semester 1 (Fall) Β· Week 5Sep 18–23

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic.

What to do if absent
Color keyLearn firstGet orientedDo the workLab daySafety netCheck yourself
Quick glossary
CER:
Claim, Evidence, Reasoning β€” make a claim, back it with evidence, explain your reasoning.
SOP:
Standard Operating Procedure β€” the exact steps to follow (especially in a lab).
Tracker:
Your PLTW progress log where you record completed evidence.
myPLTW:
The PLTW course site where you do the online activities β€” you open it through Schoology.
Learn first

Week overview - Reading the color: running an ELISA and trusting your controls

Sep 18–23

Run an ELISA, read qualitative and quantitative color results, and use positive and negative controls to judge validity.

Week arc
  1. 1Set up your plate with your samples plus a positive control and a negative control well.
  2. 2Add primary antibody, then secondary antibody, washing between steps as the protocol directs.
  3. 3Add substrate and watch for color change, timing it the same for every well.
  4. 4Record each well as positive or negative (qualitative) and note color intensity (quantitative).
  5. 5Check that your positive control turned color and your negative control stayed clear before trusting results.
  6. 6Flag any well that could be a false positive or false negative and explain why.
By week end
  • β€’ You will be able to run an ELISA and read its color results.
  • β€’ You will be able to use controls to decide whether a run is valid.
  • β€’ You will be able to explain false positive and false negative risk.
The plan

Daily lessons this week

Open any day for its full lesson, the work due that day, and guided notes.

MondayFri, Sep 18
Bioethics debate: false results

Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.

TuesdayMon, Sep 21
Controls and wet-lab plan

Numbered wet ELISA procedure, labeled plate layout with positive and negative controls marked, and predicted control colors.

WednesdayTue, Sep 22
Wet ELISA lab

Wet ELISA data table: well ID, reagent added, color result; control validation note; plate photograph.

ThursdayWed, Sep 23
Specificity vs sensitivity

2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.

Friday
ELISA lab report submission

Full ELISA lab report: plate photo, data table, claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.

Get oriented

Quick intro to the week

  • Hook: a single mislabeled or contaminated well can flip a patient's diagnosis, so controls matter.
  • Today's goal: run the ELISA, read color, and let your controls tell you whether to trust the data.
  • Connect to Monday's debate on test reliability: sensitivity and specificity are exactly today's stakes.
  • Reminder: your color-data table and control analysis are graded in the PLTW course shell.
Do the work

Your PLTW coursework this week

Do this: Advance the PLTW Unit 1 diagnostic-lab benchmark in the online course shell with your ELISA results and control check.

Know when done
  • β€’ A positive control should produce signal and a negative control should not.
  • β€’ Sensitivity and specificity describe how well a test catches true cases and avoids false alarms.
Be able to do
  • β€’ Read ELISA results both qualitatively and quantitatively.
  • β€’ Use control wells to validate or reject a test run.

πŸ“‹ PLTW tracker evidence due this week: ELISA color-data table with a written control validity check.

All PLTW activities are completed inside the PLTW course environment β€” this page only gives direction.

The plan

This week's PLTW tracker

Your week at a glance. Check off each deliverable as you finish it, then submit so Mr. Mendoza can see how the class is pacing.

Use the code Mr. Mendoza gave you, not your name. Saved on this device.

DayDateFocusKey deliverable
MondayFri, Sep 18Bioethics debate: false results Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.
TuesdayMon, Sep 21Controls and wet-lab plan Numbered wet ELISA procedure, labeled plate layout with positive and negative controls marked, and predicted control colors.
WednesdayTue, Sep 22Wet ELISA lab Wet ELISA data table: well ID, reagent added, color result; control validation note; plate photograph.
ThursdayWed, Sep 23Specificity vs sensitivity 2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.
Fridayβ€”ELISA lab report submissionFull ELISA lab report: plate photo, data table, claim with control validation, reasoning paragraph, sensitivity/specificity discussion, and limitation sentence.
Check off as you finish
  • M: debate + plate map
  • T: lab setup
  • W: ELISA data
  • Th: analysis
  • F: lab report submit

Due by week's end: ELISA lab report with controls, diagnosis, limitations.

Where are you this week?0/5 checked
Pick your period and code first.
Lab day

Lab day β€” what to bring & watch

Equipment you'll need
Pre-coated ELISA microplatePrimary antibody solutionSecondary antibody solutionSubstrate solutionWash buffer and squirt bottleMicropipettes and tipsPositive and negative control samples
HHMI BioInteractive

This explainer accompanies the PLTW lab protocol β€” watch it before lab.

Safety net

What to do when absent

If YOU are absent

Most days, this class is your PLTW coursework β€” and PLTW is online and individual. So being out usually just means doing exactly what we did in class, from home.

Open Schoology (CMSD) and keep going

How to get there: open the CMSD website, click Clever, sign in with your Microsoft (district) account, then open Schoology from Clever.

Was today a lab or a group activity?

You can't do those from home β€” do this instead: Virtual ELISA plus teacher color-data analysis.

If MR. MENDOZA is absent

Class still runs. A substitute will post today's plan β€” complete the online activity above; it's built to be self-guided. Need the concept taught without a teacher? Use this authoritative explainer:

HHMI BioInteractive
Words

Vocabulary

positive controlnegative controlspecificitysensitivityprimary antibodysecondary antibody
Explore

Teacher-posted resources

Classroom documents for this lesson. Ones marked β€œOpen the file” open right here; the rest are posted in Schoology. Use the label on each card to choose the right move.

Use during lessonFor: Everyone
MI 1.1.5 ELISA
worksheet/handoutOpens here
Open the file

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Catch-up / reteachFor: Need extra support
MI 1.1.5 ELISA Lab Results (Distance Learning)
worksheet/handoutOpens here
Open the file

Use this if you were absent, got stuck, or need another pass before you submit the lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Use during lessonFor: Everyone
Activity 1.1.5 ELISA (Bio-Rad version)
worksheet/handoutOpens here
Open the file

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

How to get there: open the CMSD website, click Clever, sign in with your Microsoft (district) account, then open Schoology from Clever.

Aligned to

Standards this week

β€’ Genetics of Disease 072130 Β· 5.5 Laboratory SOPs
β€’ Genetics of Disease 072130 Β· 5.8 Biotechnology Research and Experiments
Check yourself

WebXam practice

Tap an answer to check it Β· nothing is recorded or graded
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
In an ELISA, what is added after the primary antibody binds the antigen so that a visible result can develop?
A diagnostic test gives a color change only when the target antigen is truly present and not when it is absent. This property is best described as the test's what?
An ELISA result is read simply as a color change with no number attached. This kind of observed, non-measurable result is called what?
Submission Zone

Drop your Week 5 here. Use a clear file name (your initials + project). Routine work still goes to Schoology (via the CMSD portal).

Upload a project