Wed, Sep 23, 2026Fall (Semester 1) · Week 5Day 22 of 7780-min blockCalendar fit

Specificity vs sensitivity

Essential question: How do scientists measure how reliable a diagnostic test is, and why does the right balance depend on the disease?Enduring understanding: Sensitivity and specificity are two separate measures of a test's reliability, and the balance you want between them is set by the cost of each error for that particular disease.

Safety gate · before any work

  • Wear the required PPE, keep the bench clear, handle equipment only as directed, and know where the eyewash, sink, and spill kit are before you start.
  • Human samples and data stay private: label with a code, never a name, and dispose of materials in the correct waste container, then wash your hands.

Do now

Distinguish specificity from sensitivity and use your ELISA results to discuss how good the test is.

DueTonight, 11:29 PM
Hand in
2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.
Where
Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not.

You get two school days for every day you were absent, so this deadline moves with you.

Where you are · this course
Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. Specificity vs sensitivity ▸ Day 4
Day 22 of 77 this semester55 left before WebXam
🧬 Where you are · PLTW
Medical InterventionsUnit 1: How to Fight Infection ▸ Lesson 1.1 The Mystery Infection"Activity 1.1.5 ELISA", "Activity 1.1.6 Final Diagnosis"
Matched to your live myPLTW course (verified June 2026).
Today's driving question

Using your own results, which of your wells are true positives, true negatives, or errors, and does any odd result point to a sensitivity problem or a specificity problem?

Today you'll be able to

Distinguish specificity from sensitivity and use your results to discuss how good the test is.

You've got it when
  • You will be able to define sensitivity and specificity.
  • You will be able to classify results as true or false positives and negatives.
  • You will be able to judge a test's reliability from its results.
Due today · Data table Required2x2 classification table sorting results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.
Do-Now · start these with your notes closed
  1. In one sentence each, define sensitivity and specificity using the words 'true positive' and '.'
  2. For an outbreak screen where you want to catch everyone exposed, would you rather have high sensitivity or high specificity? Why?
Do this · step by step
numbered so we can always find our place
  1. 1Write plain definitions: sensitivity catches true positives, specificity avoids false positives.
  2. 2Sort your results into true positives, true negatives, and any apparent errors.
  3. 3Decide whether any odd result looks like a sensitivity or a specificity problem.
  4. 4Explain why a screening test often favors sensitivity over specificity.
  5. 5Connect your controls to how you would trust the test's specificity.
  6. 6Write one sentence judging how trustworthy your run was and why.
Interrupted or lost? Lost track? You should have plain definitions of sensitivity and specificity written down and your wells sorted into true positives, true negatives, and apparent errors. If not, do those first, then decide whether each odd result is a sensitivity or specificity issue and write your one-sentence trust judgment.
Optional project open: 072130 Molecular Lab Review - solo or group, about 1.5 to 2 hours total. Due by Fri, Jan 15, 2027. Great WebXam prep.
The story

What did this day actually feel like?

Specificity vs sensitivity

Sensitivity is the share of people who have it that the test catches. Specificity is the share of people who do not have it that the test correctly clears. For one given test, moving the cutoff trades them against each other: loosen it and you catch more real cases and also flag more healthy people. What breaks that trade is not a different cutoff, it is a better test.

This is Monday's ethics question with numbers attached. That ordering is not an accident.

Turned in: data table → Data Tables folder

Fiction. There is no such student. The lessons, labs and dates are the real planned course; the student, the classmates and the conversations are invented.

The comic

The same day, drawn.

Drawing, panel 28: Specificity vs sensitivity.

Sensitivity is the share of people who have it that the test catches. Specificity is the share of people who do not have it that the test correctly clears.

Panel 28Specificity vs sensitivity · 2026-09-23
Read week 6, 5 panels

Fiction. There is no such student. The lessons, labs and dates are the real planned course; the student, the classmates and the conversations are invented.

🛠 Get unstuck · pick your level

Run the lab
Sort your ELISA wells into true positives, true negatives, and errors; label any odd result as a sensitivity or specificity problem; and write a one-sentence, evidence-backed judgment of how trustworthy your run was.
Absent? Async catch-up
If sorting stalls, use your controls as anchors: the positive control is a known true positive and the negative control is a known true negative. Compare each patient well to those two, then ask whether a mismatch is a missed sick person (sensitivity) or a flagged healthy one (specificity).

Lab day: Tier 1 is the whole class at the bench. No extension today.

🔑 Today's words · 5

positive controlnegative controlspecificitysensitivityprimary antibody
+1 more in the word bank

Tap a word in the lesson for a plain meaning and one example. Recycled into next week's Do-Now.

Today's study notebook
Serial dilution, antibodies, and the ELISA test for detecting a target in a sample.
Open the notebook
Watch first: today's 1-minute intro
Audio overviewVideo overviewMind mapStudy guideFlashcardsQuizData table
Where this fits
Tested on (Ohio WebXam)
Genetics of Disease · 072130
PLTW lesson
MI · Lesson 1.1 The Mystery Infection
WebXam domain
Bio-Molecular Technology
Evidence to produce
Data table
Lab / skill
HHMI BioInteractive (preview; use fallback if blocked)
Do the work · 80-minute blockfirst 5 min = hook

💡 Big idea: Sensitivity and specificity trade off against each other, so the right balance is set by whether missing a sick person or alarming a healthy one causes more harm for that disease.

  1. 0-10 minWrite plain definitions of sensitivity and specificity; draw the 2x2 table (true positive, true negative, , )
  2. 10-25 minSort Wednesday's results into the four categories using your plate photo and
  3. 25-40 minClassify any anomalous results: sensitivity problem (missed a true positive) or specificity problem (flagged a true negative)?
  4. 40-55 minExplain in writing why a screening test favors sensitivity; connect to Monday's false-results bioethics discussion
  5. 55-68 minConnect your controls to the test's specificity: did the stay negative? Explain what it proves
  6. 68-80 minWrite one trustworthiness judgment sentence; share with a partner and defend your reasoning
Mr. Mendoza's 5-minute intro
  • A test that is 99% accurate sounds great; but if the disease is rare, most positive results could still be false positives.
  • Sensitivity and specificity are the two numbers that determine whether a test is useful for a given situation.
  • Today you apply both concepts directly to your own data from Wednesday.
  • Exit goal: a completed 2x2 classification table and a trustworthiness judgment sentence.
Know by the end
  • Sensitivity measures how well a test catches true positives (sick people who test positive); a sensitive test misses few sick people.
  • Specificity measures how well a test avoids false positives (healthy people who test positive); a specific test rarely flags healthy people as sick.
  • Screening tests (population-level) favor high sensitivity; confirmatory tests favor high specificity.
Open this PLTW section today

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Specificity vs sensitivity

Day 4 of this lesson. Open this exact section in myPLTW (find it in Clever, Microsoft sign-in), then do the work below.

Do this: Open the standard-curve analysis section of Activity 1.1.5 in myPLTW and plot your results.

Complete

Complete the , mark your unknown sample on it, and calculate its estimated concentration.

How far to get

Well-color data should be recorded (Wednesday); plotted and concentration estimated today.

Upload as evidence

Standard-curve graph with unknown marked and concentration calculated in notebook.

The official PLTW activity stays inside myPLTW. If myPLTW will not open, use F1 and E1-E3 on this page to complete today's local evidence decision, then make up the official activity when access returns. Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not.

Today's PLTW tracker · fill in and submit

Check things off as you work, then submit. This tells Mr. Mendoza how you're doing so he can help the class. It does not replace turning in your producible through the submission route shown below.

Use the code Mr. Mendoza gave you, not your name. Saved on this device.

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic.Day 4 of this projectSee the full week plan
Today's PLTW target

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Specificity vs sensitivity

Open the standard-curve analysis section of Activity 1.1.5 in myPLTW and plot your results.

Well-color data should be recorded (Wednesday); plotted and concentration estimated today.

This is how Mr. Mendoza sees the class keeping pace with PLTW. Be honest, it only helps if it is accurate.

1 · What you do today

🎯 Distinguish specificity from sensitivity and use your results to discuss how good the test is.

  • Write plain definitions: sensitivity catches true positives, specificity avoids false positives.
  • Sort your results into true positives, true negatives, and any apparent errors.
  • Decide whether any odd result looks like a sensitivity or a specificity problem.
  • Explain why a screening test often favors sensitivity over specificity.
  • Connect your controls to how you would trust the test's specificity.
  • Write one sentence judging how trustworthy your run was and why.
2 · What you turn in

Data table: 2x2 classification table sorting results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.

Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not. Use the checklist just below and upload by 11:29 PM for full credit. Absent with an excused absence? You get two school days for every day you were absent, so this deadline moves with you.

3 · Who's doing what (team)
TaskWho
Write plain definitions: sensitivity catches true positives, specificity avoids false positives._______
Sort your results into true positives, true negatives, and any apparent errors._______
Decide whether any odd result looks like a sensitivity or a specificity problem._______
Explain why a screening test often favors sensitivity over specificity._______
Connect your controls to how you would trust the test's specificity._______
Write one sentence judging how trustworthy your run was and why._______

Working solo? Put your own name in "Who" for every row.

4 · Words I can use correctly
5 · I'm successful today when I can…
  • You will be able to define sensitivity and specificity.
  • You will be able to classify results as true or false positives and negatives.
  • You will be able to judge a test's reliability from its results.
6 · Reflection & next steps
Where are you today?0/9 checked
Pick your period and code first.
Your 4 steps today
  1. 1
    Do this
    Distinguish specificity from sensitivity and use your ELISA results to discuss how good the test is.
  2. 2
  3. 3
    Submit this
    Data table: 2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.
  4. 4
    Submit it here
    1. 1Open the drop folder.
    2. 2Sign in with your district Microsoft account, not a personal one.
    3. 3Upload the file, named Lastname_Firstname__Assignment Title.
    4. 4Your own upload panel says Uploaded with a green check: that is your receipt.
    Turn this in at the drop folder with your district Microsoft sign-in, or hand it to Mr. Mendoza in class. Both count as submitted. Doing the activity in myPLTW does not. Genetics of Disease (Medical Interventions) › Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. › Data table
    Open the drop folder
Were you absent? Jump to the make-up plan
Learn it · deck, reading, and vocabulary
Socratic teaching slide deck

The deck carries the prior idea forward, lets you inspect an analogy, maps the rule to biology, and ends with the same evidence decision and exit ticket used on this page.

Generated from this lesson's canonical data with a red-team citation check.

Carry forward

works only when steps run in exact order and timing, because each layer must bind before the next so that the final color measures and not error.

Daily take-home

Sensitivity and specificity trade off against each other, so the right balance is set by whether missing a sick person or alarming a healthy one causes more harm for that disease.

Inspect the analogy

A smoke alarm detects signs of fire but can also react to burnt toast.

  1. What does the alarm detect?
  2. What creates a false alarm?
  3. What evidence is needed before declaring a fire?
Rule

A screening signal changes what to investigate next; it does not automatically prove the cause.

Where it breaks

Biomedical tests have measured performance and biological sampling limits that a household alarm does not capture.

Map the analogy to biology
  • Alarm signal maps to a test result.
  • Burnt toast maps to a .
  • Inspection maps to confirmation or the next test.
Read this first

Driving question: Using your own results, which of your wells are true positives, true negatives, or errors, and does any odd result point to a sensitivity problem or a specificity problem?

What you already know: works only when steps run in exact order and timing, because each layer must bind before the next so that the final color measures and not error.

New idea: Sensitivity and specificity trade off against each other, so the right balance is set by whether missing a sick person or alarming a healthy one causes more harm for that disease.

Visual or model: F1. F1. A lesson illustration or teaching diagram for Specificity vs sensitivity. Use it with E1-E3; it is a model or context image, not experimental or patient data. What to notice: Trace the labeled testing, treatment, or biological process and identify where evidence limits the decision.

  1. Observe or measure the relevant feature in Specificity vs sensitivity.
  2. Organize the observation with a stable evidence ID.
  3. Apply this rule: A screening signal changes what to investigate next; it does not automatically prove the cause.
  4. Choose the option the evidence supports and state the limit of the conclusion.

Real biomedical example: Using your own results, which of your wells are true positives, true negatives, or errors, and does any odd result point to a sensitivity problem or a specificity problem?

What the evidence supports: E1-E3 and F1 support the daily take-home when the response meets the stated success criteria.

What it cannot prove: The package does not support claims beyond this lesson's or any real patient diagnosis.

Vocabulary:
  • : A sample known to produce a result, included in an experiment to confirm that the test is working correctly.
  • : A sample in an experiment expected to show no effect, used as a baseline to confirm that any result in the test sample is real.
  • specificity: A test's ability to correctly identify people who do not have a condition, giving few false positives.
  • sensitivity: A test's ability to correctly identify people who truly have a disease, measured as the share of real cases that the test flags as positive.
  • : The first added in a test that binds directly to the target molecule, marking it so it can be detected later.
  • : An that binds to a and carries a tag, such as a dye or , to make the target visible in a test.

Use it now: Choose one decision option. Cite E1 and E3, then explain how the rule connects the evidence to your choice.

Go further, optional: The source links below are optional enrichment. Every fact required for today's local evidence decision appears in this lesson package.

Evidence set and decision
E1 · Observation

Sensitivity measures how well a test catches true positives (sick people who test positive); a sensitive test misses few sick people.

Limit: E1 supplies context or an observation; it does not by itself establish the explanation.

E2 · Mechanism

Sensitivity and specificity trade off against each other, so the right balance is set by whether missing a sick person or alarming a healthy one causes more harm for that disease.

Limit: E2 is a teaching statement or comparison and must be checked against the task evidence.

E3 · Result

You will be able to define sensitivity and specificity.

Limit: E3 supports only the result or product criterion named here; it cannot justify a broader clinical or causal claim.

PLTW-GEND-2026-09-23 · Simulated classroom evidence scenario

Your role: medical interventions team member

Decision: Your team must decide what the evidence from Specificity vs sensitivity supports before submitting the labeled and result claim named on the lesson page.

  • Choose the strongest supported explanation.
  • Choose the next evidence to collect.
  • Hold the decision because the evidence is insufficient.

Response: State one choice, cite at least two evidence IDs, explain the rule that connects them, and add one limitation. Submit it as the labeled and result claim.

Claim ceiling: The supplied lesson evidence can support an observation, pattern, classroom mechanism, or next-step decision about Specificity vs sensitivity. It cannot by itself prove causation, establish a real clinical diagnosis, or justify action outside this classroom task.

Composite case file · PLTW-GEND-2026-09-23

Reason for review: Your team must decide what the evidence from Specificity vs sensitivity supports before submitting the labeled and result claim named on the lesson page.

Context: Sensitivity and specificity are two separate measures of a test's reliability, and the balance you want between them is set by the cost of each error for that particular disease.

Timeline:
  • T1: Write plain definitions: sensitivity catches true positives, specificity avoids false positives.
  • T2: Sort your results into true positives, true negatives, and any apparent errors.
  • T3: Decide whether any odd result looks like a sensitivity or a specificity problem.
  • T4: Explain why a screening test often favors sensitivity over specificity.
  • T5: Connect your controls to how you would trust the test's specificity.
  • T6: Write one sentence judging how trustworthy your run was and why.
Evidence records:
  • E1: Sensitivity measures how well a test catches true positives (sick people who test positive); a sensitive test misses few sick people.
  • E2: Sensitivity and specificity trade off against each other, so the right balance is set by whether missing a sick person or alarming a healthy one causes more harm for that disease.
  • E3: You will be able to define sensitivity and specificity.

Measurements: Use only the measurements, units, graph, or counts supplied in today's task. No additional patient measurement is implied.

Figure finding: Teaching diagram for Specificity vs sensitivity. Trace the labeled testing, treatment, or biological process and identify where evidence limits the decision. This is a teaching model, not patient or experimental data.

Uncertainty: This is a composite classroom scenario. Missing history, measurements, or confirmation tests remain unknown and limit the conclusion.

Math moment
Formula or setup

For a linear , y = mx + b. To estimate an unknown concentration, use x = (y - b) / m.

Worked parallel example

A is y = 0.40x + 0.10. An unknown signal is 0.90. x = (0.90 - 0.10) / 0.40 = 2.0 concentration units.

Units and reasonableness

Signal units belong on y. Concentration units belong on x. Confirm the unknown falls inside the standards before interpreting it.

Try it with today's data

Use the equation or graph supplied today to estimate one unknown. Show the substitution, concentration unit, and range check.

Design record
Criteria
  • The solution must address the stated need in Specificity vs sensitivity.
  • The decision must be supported by E1-E3.
  • The final product must make the success criteria visible.
Constraints
  • Complete the work inside the 80-minute block.
  • Use only supplied or teacher-approved materials and evidence.
  • Do not trade , accessibility, or privacy for speed.
Tradeoff weights
  • and evidence quality: must pass before scoring other criteria.
  • User need and effectiveness: highest scored criterion.
  • Time, cost, and ease of use: compare only after and effectiveness pass.

Test evidence: For each option, record the E1-E3 result that supports or fails each criterion. Do not assign a score without a named observation.

Iteration log
  1. Version or option tested
  2. Criterion met or missed
  3. Evidence ID and result
  4. Revision made
  5. Reason for the revision
Decision record
  1. Need and user
  2. Criteria and constraints
  3. Chosen option and evidence
  4. Test result
  5. Revision and reason
Watch the trap

Students often think Students treat sensitivity and specificity as the same thing (just 'accuracy') and assume a good test maximizes both at once.. The trap: Sensitivity and specificity are different and they trade off, because moving the threshold to catch more sick people (higher sensitivity) also flags more healthy people (lower specificity); no single dial makes both perfect.

Worked example · a parallel case (guides, does not reveal)
2x2 classification table
Completes: A two-by-two table sorting ELISA results into true and false positives and negatives, with a one-sentence judgment of the run's reliability that cites the controls.

Definitions: sensitivity catches true positives (sick people who test positive); specificity avoids false positives (healthy people who test positive).

Reliability judgment: because my positive control turned color and my negative control stayed clear, I trust this run's specificity, and the one odd result looks like a sensitivity issue (a known-positive sample that read weak), not contamination.

Actually sickActually healthy
Test positiveTrue positiveFalse positive
Test negativeFalse negativeTrue negative
Two by two classification table showing true positive, false positive, false negative, and true negative cells.
Why this matters

This model shows the level of evidence and organization needed to complete: A two-by-two table sorting ELISA results into true and false positives and negatives, with a one-sentence judgment of the run's reliability that cites the controls.

Build yours step by step
  1. Name the variables and include units.
  2. Enter observations without changing the raw values.
  3. Check labels, calculations, and patterns before interpreting the data.
Change it for a new task

Keep the structure. Replace the question, facts, measurements, and evidence. Then recheck units, vocabulary, and whether the conclusion goes beyond the evidence.

Also due today: Bring to Friday's report writing session; include in the lab report.

See the full worked example
Portal terms
CER:
Claim, Evidence, Reasoning: make a claim, back it with evidence, explain your reasoning.
SOP:
Standard Operating Procedure, the exact steps to follow (especially in a lab).
Tracker:
Your PLTW progress log where you record completed evidence.
myPLTW:
The PLTW course site where you do the online activities. Find it in Clever with your Microsoft sign-in, right next to Schoology.
This unit's vocabulary

Tap the speaker to hear a term. Add two of these to your notebook glossary with a definition and an example in your own words.

Build your vocabulary · optional, for extra credit

Pick just 2 or 3 words from today and make them yours: write what each one means in your own words, name the context clue or evidence that helped, then give one example from what you actually did in Specificity vs sensitivity. Try your own words first; the glossary is there if you get stuck. This is voluntary and counts as extra credit, so keep it short.

positive control
negative control
specificity
sensitivity
primary antibody
secondary antibody

Saved on this device. Show Mr. Mendoza or add these to your notebook glossary to claim the extra credit.

Teacher-posted resources

Classroom documents for this lesson are posted in Schoology. Open Clever, then Schoology, and find each one by the name shown on its card.

Use during lessonFor: Everyone
MI 1.1.5 ELISA
worksheet/handoutPosted in Schoology
Open in Schoology

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Catch-up / reteachFor: Need extra support
MI 1.1.5 ELISA Lab Results (Distance Learning)
worksheet/handoutPosted in Schoology
Open in Schoology

Use this if you were absent, got stuck, or need another pass before you submit the lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Use during lessonFor: Everyone
Activity 1.1.5 ELISA (Bio-Rad version)
worksheet/handoutPosted in Schoology
Open in Schoology

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

How to get there: open Clever and sign in with your Microsoft (district) account. Both myPLTW and Schoology are in Clever. Do the activity in myPLTW. Turn the work in on this site or hand it to Mr. Mendoza, because that is the step that counts as submitted. Schoology only shows your report-card grade later.

Check yourself · commit, then reveal

Claim ceiling for this check: The supplied lesson evidence can support an observation, pattern, classroom mechanism, or next-step decision about Specificity vs sensitivity. It cannot by itself prove causation, establish a real clinical diagnosis, or justify action outside this classroom task.

Quick self-check · commit, then reveal

A screening ELISA for an outbreak lets a truly infected person's well stay clear (a negative result). Is this a sensitivity failure or a specificity failure, and why is it especially dangerous for a screening test?

How sure are you?

Write an answer and pick a confidence to unlock the key.

Cumulative WebXam review · flash practice

Fast retrieval with instant answers, not the commit-then-reveal check above. Try each from memory first: write what you remember about the earlier units, then check yourself here.

Tap an answer to check it · nothing is recorded or graded
[Review: Framing an Outbreak Investigation] Which microbiology principle states that one specific organism causes a specific disease and can be isolated from a host who has that disease?
[Review: Who is the culprit? Identifying a pathogen with DNA and BLAST] What was the landmark international collaboration that identified the nucleotide base pairs of humans?
[Review: Getting ready to test: serial dilutions and the ELISA setup] A technician makes a serial dilution starting with 100 ng/mL of antigen, transferring equal parts antigen and water at each step. What is the concentration after the first two dilutions?
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
Go further and get help
Lab · prepare, conduct, complete
1Prepare
Pre-lab pass · clear all six to go to the bench
0/6

I can name the procedure's purpose and the evidence I will record. I can identify each named hazard and the control that reduces it: Wear the required PPE, keep the bench clear, handle equipment only as directed, and know where the eyewash, sink, and spill kit are before you start. My data table is ready before materials are handled.

Finish the checklist before you handle any material.

Bring / set up
Pre-coated ELISA microplatePrimary antibody solutionSecondary antibody solutionSubstrate solutionWash buffer and squirt bottleMicropipettes and tipsPositive and negative control samples
Safety · specific to today's hazards
  • Wear the required PPE, keep the bench clear, handle equipment only as directed, and know where the eyewash, sink, and spill kit are before you start.
  • Human samples and data stay private: label with a code, never a name, and dispose of materials in the correct waste container, then wash your hands.
Review Lab Safety (rules, PPE, SDS, emergencies) and check your contract + test
2Conduct (Argument-Driven Inquiry)
  1. 1Before materials are handled, identify the purpose, variables or comparison, controls, measurement units, and stop-work condition.
  2. 2Write plain definitions: sensitivity catches true positives, specificity avoids false positives.
  3. 3Sort your ELISA results into true positives, true negatives, and any apparent errors.
  4. 4Decide whether any odd result looks like a sensitivity or a specificity problem.
  5. 5Explain why a screening test often favors sensitivity over specificity.
  6. 6Connect your controls to how you would trust the test's specificity.
  7. 7Write one sentence judging how trustworthy your ELISA run was and why.
  8. 8Record each result in the prepared table before interpreting it. Mark missing, repeated, or invalid results truthfully.
  9. 9Complete the named cleanup and waste route, remove PPE safely, wash hands when required, and confirm the station is ready for the next group.
Prepare this data table before materials are handled
Trial or sample IDIndependent conditionMeasured result with unitsObservation before interpretationQuality-control note
     
     
     
HHMI BioInteractive (preview; use fallback if blocked)
3Complete
Argue from your evidence, then compare what you predicted to what happened. Error analysis names a specific method limit, never "human error".
You predicted

Before the procedure, predict the result and cite the rule behind the prediction.

What actually happened

After the procedure, compare the result with the prediction and name one limitation or source of uncertainty.

Your lab report is graded on the rubric below, with extra weight on error analysis and method.
Where this leads: careers

What today's skills lead to. These are real health-science careers this course builds toward. Tap one to see, on the US Department of Labor's O*NET site, what the job actually involves, what it pays, and how fast it is growing.

What to do if you were absent
This one used the bench

The bench work needs equipment you do not have at home. Do the thinking half now: read the procedure, write your prediction, and set up your data table so it is ready.

Back in class. Ask Mr. Mendoza for the class data set, or for a bench slot to run it yourself. Do not submit a Data table with invented numbers.

If MR. MENDOZA is absent

Class still runs. Complete the online activity above (it's self-guided). Need the concept taught without a teacher? Use this authoritative explainer:

HHMI BioInteractive (preview; use fallback if blocked)
How this is graded
For: Data table: 2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.
  • Complete
    Every required part of the artifact is present, nothing left blank.
  • Accurate
    The science and the data are correct and match the evidence.
  • Scientific reasoning
    You explain your claim with evidence and reasoning (CER), not just an answer.
  • Professional communication
    Clear, organized, labeled, and written the way a clinician or scientist would.
  • Submitted
    Turned in the right way, on the class site or handed to Mr. Mendoza in class, and confirmed. Not in Schoology: that is where the report-card grade appears later.
  • Error analysis and method · counts double
    Name a specific limit of the method and how it moved your result, and compare what you predicted to what happened. "Human error" does not count; say what about the procedure or instrument caused it.