Wed, Sep 23, 2026Fall (Semester 1) · Week 5Day 22 of 6780-min block

Specificity vs sensitivity

Today's target

Distinguish specificity from sensitivity and use your ELISA results to discuss how good the test is.

Due today · Data table Required

2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.

Your 4 steps today
  1. 1
    Do this
    Distinguish specificity from sensitivity and use your ELISA results to discuss how good the test is.
  2. 2
  3. 3
    Submit this
    Data table: 2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.
  4. 4
    Submit it here
    1. 1CMSD website. Go to clevelandmetroschools.org and click the Clever button.
    2. 2Clever. Clever opens. Sign in if it asks.
    3. 3Microsoft (district) login. Use your district Microsoft account (the one for school).
    4. 4Schoology. Open Schoology, then your class, then Assignments, and find the file named below.
    The file to submit is named: Genetics of Disease (Medical Interventions) › Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. › Data table
    Open Schoology
Were you absent? Jump to the make-up plan
Where this fits
Tested on (Ohio WebXam)
Genetics of Disease · 072130
PLTW lesson
MI · Specificity vs sensitivity
WebXam domain
Bio-Molecular Technology
Evidence to produce
Data table
Lab / skill
HHMI BioInteractive
Quick glossary
CER:
Claim, Evidence, Reasoning — make a claim, back it with evidence, explain your reasoning.
SOP:
Standard Operating Procedure — the exact steps to follow (especially in a lab).
Tracker:
Your PLTW progress log where you record completed evidence.
myPLTW:
The PLTW course site where you do the online activities — you open it through Schoology.
Learn first

Minute-by-minute · 80-minute block

💡 Big idea: How do scientists measure the reliability of a diagnostic test, and why does the right balance depend on the disease?

  1. 0-10 minWrite plain definitions of sensitivity and specificity; draw the 2x2 table (true positive, true negative, false positive, false negative)
  2. 10-25 minSort Wednesday's ELISA results into the four categories using your plate photo and data table
  3. 25-40 minClassify any anomalous results: sensitivity problem (missed a true positive) or specificity problem (flagged a true negative)?
  4. 40-55 minExplain in writing why a screening test favors sensitivity; connect to Monday's false-results bioethics discussion
  5. 55-68 minConnect your controls to the test's specificity: did the negative control stay negative? Explain what it proves
  6. 68-80 minWrite one trustworthiness judgment sentence; share with a partner and defend your reasoning
Mr. Mendoza's 5-minute intro
  • A test that is 99% accurate sounds great; but if the disease is rare, most positive results could still be false positives.
  • Sensitivity and specificity are the two numbers that determine whether a test is useful for a given situation.
  • Today you apply both concepts directly to your own ELISA data from Wednesday.
  • Exit goal: a completed 2x2 classification table and a trustworthiness judgment sentence.
Do this, step by step
  1. 1Write plain definitions: sensitivity catches true positives, specificity avoids false positives.
  2. 2Sort your ELISA results into true positives, true negatives, and any apparent errors.
  3. 3Decide whether any odd result looks like a sensitivity or a specificity problem.
  4. 4Explain why a screening test often favors sensitivity over specificity.
  5. 5Connect your controls to how you would trust the test's specificity.
  6. 6Write one sentence judging how trustworthy your ELISA run was and why.
You'll be able to
  • You will be able to define sensitivity and specificity.
  • You will be able to classify results as true or false positives and negatives.
  • You will be able to judge a test's reliability from its results.
Know by the end
  • Sensitivity measures how well a test catches true positives (sick people who test positive); a sensitive test misses few sick people.
  • Specificity measures how well a test avoids false positives (healthy people who test positive); a specific test rarely flags healthy people as sick.
  • Screening tests (population-level) favor high sensitivity; confirmatory tests favor high specificity.
📺 Tutor me: Khan Academy: Sensitivity and specificity
Do the work

Your PLTW work today

Open this PLTW section today

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Specificity vs sensitivity

Day 4 of this lesson. Open this exact section in myPLTW (reached through Schoology), then do the work below.

Do this: Open the standard-curve analysis section of Activity 1.1.5 ELISA in myPLTW and plot your results.

Complete

Complete the standard curve, mark your unknown sample on it, and calculate its estimated concentration.

How far to get

Well-color data should be recorded (Wednesday); standard curve plotted and concentration estimated today.

Upload as evidence

Standard-curve graph with unknown marked and concentration calculated in notebook.

All PLTW activities are completed inside the PLTW course environment — this page only gives direction. Submit producibles on Schoology.

The plan

Today's PLTW tracker

Check things off as you work, then submit. This tells Mr. Mendoza how you're doing so he can help the class. It does not replace turning in your producible on Schoology.

Use the code Mr. Mendoza gave you, not your name. Saved on this device.

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic.Day 4 of this projectSee the full week plan
Today's PLTW target

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Specificity vs sensitivity

Open the standard-curve analysis section of Activity 1.1.5 ELISA in myPLTW and plot your results.

Well-color data should be recorded (Wednesday); standard curve plotted and concentration estimated today.

This is how Mr. Mendoza sees the class keeping pace with PLTW. Be honest, it only helps if it is accurate.

1 · What you do today

🎯 Distinguish specificity from sensitivity and use your ELISA results to discuss how good the test is.

  • Write plain definitions: sensitivity catches true positives, specificity avoids false positives.
  • Sort your ELISA results into true positives, true negatives, and any apparent errors.
  • Decide whether any odd result looks like a sensitivity or a specificity problem.
  • Explain why a screening test often favors sensitivity over specificity.
  • Connect your controls to how you would trust the test's specificity.
  • Write one sentence judging how trustworthy your ELISA run was and why.
2 · Turn in today

Data table: 2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.

Submit on Schoology

Upload by 11:29 PM for full credit.

3 · Who's doing what (team)
TaskWho
Write plain definitions: sensitivity catches true positives, specificity avoids false positives._______
Sort your ELISA results into true positives, true negatives, and any apparent errors._______
Decide whether any odd result looks like a sensitivity or a specificity problem._______
Explain why a screening test often favors sensitivity over specificity._______
Connect your controls to how you would trust the test's specificity._______
Write one sentence judging how trustworthy your ELISA run was and why._______

Working solo? Put your own name in "Who" for every row.

4 · Words I can use correctly
5 · I'm successful today when I can…
  • You will be able to define sensitivity and specificity.
  • You will be able to classify results as true or false positives and negatives.
  • You will be able to judge a test's reliability from its results.
6 · Reflection & next steps
Where are you today?0/9 checked
Pick your period and code first.
Explore

Teacher-posted resources

Classroom documents for this lesson. Ones marked “Open the file” open right here; the rest are posted in Schoology. Use the label on each card to choose the right move.

Use during lessonFor: Everyone
MI 1.1.5 ELISA
worksheet/handoutOpens here
Open the file

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Catch-up / reteachFor: Need extra support
MI 1.1.5 ELISA Lab Results (Distance Learning)
worksheet/handoutOpens here
Open the file

Use this if you were absent, got stuck, or need another pass before you submit the lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Use during lessonFor: Everyone
Activity 1.1.5 ELISA (Bio-Rad version)
worksheet/handoutOpens here
Open the file

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

How to get there: open the CMSD website, click Clever, sign in with your Microsoft (district) account, then open Schoology from Clever.

Lab day

Lab & supplies

Bring / set up
Pre-coated ELISA microplatePrimary antibody solutionSecondary antibody solutionSubstrate solutionWash buffer and squirt bottleMicropipettes and tipsPositive and negative control samples
HHMI BioInteractive
Words

This unit's vocabulary

positive controlnegative controlspecificitysensitivityprimary antibodysecondary antibody

Tap the speaker to hear a term. Weekly vocabulary task: add two of these terms to your notebook glossary with a definition and an example in your own words.

Check yourself

WebXam practice

Tap an answer to check it · nothing is recorded or graded
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
In an ELISA, what is added after the primary antibody binds the antigen so that a visible result can develop?
A diagnostic test gives a color change only when the target antigen is truly present and not when it is absent. This property is best described as the test's what?
An ELISA result is read simply as a color change with no number attached. This kind of observed, non-measurable result is called what?
Check yourself

Cumulative WebXam review

A quick mixed-review pulling questions from earlier units plus today, so the WebXam material stays fresh.

Tap an answer to check it · nothing is recorded or graded
[Review: Framing an Outbreak Investigation] Which microbiology principle states that one specific organism causes a specific disease and can be isolated from a host who has that disease?
[Review: Who is the culprit? Identifying a pathogen with DNA and BLAST] What was the landmark international collaboration that identified the nucleotide base pairs of humans?
[Review: Getting ready to test: serial dilutions and the ELISA setup] A technician makes a serial dilution starting with 100 ng/mL of antigen, transferring equal parts antigen and water at each step. What is the concentration after the first two dilutions?
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
Explore

Where this leads — careers

What today's skills lead to. These are real health-science careers this course builds toward. Tap one to see, on the US Department of Labor's O*NET site, what the job actually involves, what it pays, and how fast it is growing.

Safety net

What to do if you were absent

If YOU are absent

Today is individual PLTW work, so do exactly what we did in class, from home: complete the same PLTW target above, then submit your Data table.

Open Schoology (CMSD) and keep going

How to get there: open the CMSD website, click Clever, sign in with your Microsoft (district) account, then open Schoology from Clever.

If MR. MENDOZA is absent

Class still runs. Complete the online activity above (it's self-guided). Need the concept taught without a teacher? Use this authoritative explainer:

HHMI BioInteractive
How this is graded
For: Data table — 2x2 classification table sorting ELISA results into true/false positives and negatives, plus a one-sentence reliability judgment citing controls.
  • Complete
    Every required part of the artifact is present, nothing left blank.
  • Accurate
    The science and the data are correct and match the evidence.
  • Scientific reasoning
    You explain your claim with evidence and reasoning (CER), not just an answer.
  • Professional communication
    Clear, organized, labeled, and written the way a clinician or scientist would.
  • Submitted
    Turned in the right way (Schoology for routine work) and confirmed.
Submission Zone

Drop your Wed, Sep 23, 2026 · Specificity vs sensitivity here. Use a clear file name (your initials + project). Routine work still goes to Schoology (via the CMSD portal).

Upload a project