Tue, Feb 16, 2027Spring (Semester 2) · Week 5Day 19 of 6780-min block

Bioethics debate: false results

Today's target

Debate the ethics of using a diagnostic test that sometimes gives false positives or false negatives.

Due today · CER Required

Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.

Your 4 steps today
  1. 1
    Do this
    Debate the ethics of using a diagnostic test that sometimes gives false positives or false negatives.
  2. 2
  3. 3
    Submit this
    CER: Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.
  4. 4
    Submit it here
    1. 1CMSD website. Go to clevelandmetroschools.org and click the Clever button.
    2. 2Clever. Clever opens. Sign in if it asks.
    3. 3Microsoft (district) login. Use your district Microsoft account (the one for school).
    4. 4Schoology. Open Schoology, then your class, then Assignments, and find the file named below.
    The file to submit is named: Genetics of Disease (Medical Interventions) › Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. › CER
    Open Schoology
Were you absent? Jump to the make-up plan
Where this fits
Tested on (Ohio WebXam)
Genetics of Disease · 072130
PLTW lesson
MI · Bioethics debate: false results
WebXam domain
Bio-Molecular Technology
Evidence to produce
CER
Lab / skill
HHMI BioInteractive
Quick glossary
CER:
Claim, Evidence, Reasoning — make a claim, back it with evidence, explain your reasoning.
SOP:
Standard Operating Procedure — the exact steps to follow (especially in a lab).
Tracker:
Your PLTW progress log where you record completed evidence.
myPLTW:
The PLTW course site where you do the online activities — you open it through Schoology.
Learn first

Minute-by-minute · 80-minute block

💡 Big idea: Is it ethical to use a medical test that sometimes gives the wrong answer, and what conditions change that answer?

  1. 0-10 minRead scenario; define false positive and false negative in notebook with a clinical example each
  2. 10-25 minDraft CER: claim (ethical or not, under what conditions), reason, evidence from the scenario
  3. 25-40 minPartner exchange: find someone with a different view; record their strongest point
  4. 40-55 minWrite rebuttal; revise claim if the counterpoint exposed a gap in reasoning
  5. 55-68 minPost CER to the discussion board
  6. 68-80 minRead two classmates' CERs; leave a one-sentence response to each
Mr. Mendoza's 5-minute intro
  • No medical test is perfect; the question is never 'is this test perfect?' but 'are the errors this test makes acceptable given what's at stake?'
  • False negatives for HIV versus false positives for a low-risk condition carry very different ethical weights.
  • This debate connects directly to the specificity and sensitivity analysis you will do Thursday after running your real ELISA.
  • Exit goal: a posted CER arguing for or against using an imperfect test, with a rebuttal addressing the opposing view.
Do this, step by step
  1. 1Read the scenario: a test is fast and cheap but occasionally wrong in both directions.
  2. 2Write your Claim: is it ethical to use this test, and under what conditions?
  3. 3Add a Reason that weighs the harm of a false positive against a false negative.
  4. 4Find a partner with a different view and note their strongest point.
  5. 5Write a Rebuttal that addresses it.
  6. 6Post your CER and read how two classmates handled the false-result tradeoff.
You'll be able to
  • You will be able to argue when an imperfect test is ethical to use.
  • You will be able to compare the harms of false positives and false negatives.
  • You will be able to rebut an opposing view.
Know by the end
  • A false positive tells a healthy person they are sick; a false negative tells a sick person they are healthy; the harms of each differ by context.
  • Sensitivity and specificity are the technical measures of a test's accuracy: they can be traded off against each other by adjusting the threshold.
  • Ethical use of an imperfect test depends on the consequences of each type of error in the specific clinical context.
Do the work

Your PLTW work today

Open this PLTW section today

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Bioethics debate: false results

Day 1 of this lesson. Open this exact section in myPLTW (reached through Schoology), then do the work below.

Do this: Open the false-results bioethics discussion activity in myPLTW for Lesson 1.1 The Mystery Infection and review the CER rubric.

Complete

Post your CER on using an imperfect test and reply to at least two classmates.

How far to get

ELISA pre-lab packet should be submitted; this debate opens the wet-lab week.

Upload as evidence

CER post visible in the course discussion board.

All PLTW activities are completed inside the PLTW course environment — this page only gives direction. Submit producibles on Schoology.

The plan

Today's PLTW tracker

Check things off as you work, then submit. This tells Mr. Mendoza how you're doing so he can help the class. It does not replace turning in your producible on Schoology.

Use the code Mr. Mendoza gave you, not your name. Saved on this device.

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic.Day 1 of this projectSee the full week plan
Today's PLTW target

Reading qualitative vs. quantitative color results; false positive/negative risk; control logic. · Bioethics debate: false results

Open the false-results bioethics discussion activity in myPLTW for Lesson 1.1 The Mystery Infection and review the CER rubric.

ELISA pre-lab packet should be submitted; this debate opens the wet-lab week.

This is how Mr. Mendoza sees the class keeping pace with PLTW. Be honest, it only helps if it is accurate.

1 · What you do today

🎯 Debate the ethics of using a diagnostic test that sometimes gives false positives or false negatives.

  • Read the scenario: a test is fast and cheap but occasionally wrong in both directions.
  • Write your Claim: is it ethical to use this test, and under what conditions?
  • Add a Reason that weighs the harm of a false positive against a false negative.
  • Find a partner with a different view and note their strongest point.
  • Write a Rebuttal that addresses it.
  • Post your CER and read how two classmates handled the false-result tradeoff.
2 · Turn in today

CER: Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.

Submit on Schoology

Upload by 11:29 PM for full credit.

3 · Who's doing what (team)
TaskWho
Read the scenario: a test is fast and cheap but occasionally wrong in both directions._______
Write your Claim: is it ethical to use this test, and under what conditions?_______
Add a Reason that weighs the harm of a false positive against a false negative._______
Find a partner with a different view and note their strongest point._______
Write a Rebuttal that addresses it._______
Post your CER and read how two classmates handled the false-result tradeoff._______

Working solo? Put your own name in "Who" for every row.

4 · Words I can use correctly
5 · I'm successful today when I can…
  • You will be able to argue when an imperfect test is ethical to use.
  • You will be able to compare the harms of false positives and false negatives.
  • You will be able to rebut an opposing view.
6 · Reflection & next steps
Where are you today?0/9 checked
Pick your period and code first.
Explore

Teacher-posted resources

Classroom documents for this lesson. Ones marked “Open the file” open right here; the rest are posted in Schoology. Use the label on each card to choose the right move.

Use during lessonFor: Everyone
MI 1.1.5 ELISA
worksheet/handoutOpens here
Open the file

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Catch-up / reteachFor: Need extra support
MI 1.1.5 ELISA Lab Results (Distance Learning)
worksheet/handoutOpens here
Open the file

Use this if you were absent, got stuck, or need another pass before you submit the lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

Use during lessonFor: Everyone
Activity 1.1.5 ELISA (Bio-Rad version)
worksheet/handoutOpens here
Open the file

Open this when the class reaches this activity and use it to complete the required lesson artifact.

Placement rationale

Matched ELISA lab, controls, diagnosis limits by path:Medical-Interventions/Unit-1_How-to-Fight-Infection/1.1_The-Mystery-Infection; keywords:elisa, lab. Score 138. Visibility: student-schoology (student-facing resource; link through Schoology rather than local path).

How to get there: open the CMSD website, click Clever, sign in with your Microsoft (district) account, then open Schoology from Clever.

Lab day

Lab & supplies

Bring / set up
Pre-coated ELISA microplatePrimary antibody solutionSecondary antibody solutionSubstrate solutionWash buffer and squirt bottleMicropipettes and tipsPositive and negative control samples
HHMI BioInteractive
Words

This unit's vocabulary

positive controlnegative controlspecificitysensitivityprimary antibodysecondary antibody

Tap the speaker to hear a term. Weekly vocabulary task: add two of these terms to your notebook glossary with a definition and an example in your own words.

Check yourself

WebXam practice

Tap an answer to check it · nothing is recorded or graded
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
In an ELISA, what is added after the primary antibody binds the antigen so that a visible result can develop?
A diagnostic test gives a color change only when the target antigen is truly present and not when it is absent. This property is best described as the test's what?
An ELISA result is read simply as a color change with no number attached. This kind of observed, non-measurable result is called what?
Check yourself

Cumulative WebXam review

A quick mixed-review pulling questions from earlier units plus today, so the WebXam material stays fresh.

Tap an answer to check it · nothing is recorded or graded
[Review: Framing an Outbreak Investigation] Which microbiology principle states that one specific organism causes a specific disease and can be isolated from a host who has that disease?
[Review: Who is the culprit? Identifying a pathogen with DNA and BLAST] What was the landmark international collaboration that identified the nucleotide base pairs of humans?
[Review: Getting ready to test: serial dilutions and the ELISA setup] A technician makes a serial dilution starting with 100 ng/mL of antigen, transferring equal parts antigen and water at each step. What is the concentration after the first two dilutions?
Why is a no-inoculum (no-template) negative control critical when running a panel of assays or cultures?
Explore

Where this leads — careers

What today's skills lead to. These are real health-science careers this course builds toward. Tap one to see, on the US Department of Labor's O*NET site, what the job actually involves, what it pays, and how fast it is growing.

Safety net

What to do if you were absent

Today was a debate — do this instead

If you are away, post a full CER on whether an imperfect test should be used and reply to one classmate with a rebuttal.

Then submit your CER on Schoology.

If MR. MENDOZA is absent

Class still runs. Complete the online activity above (it's self-guided). Need the concept taught without a teacher? Use this authoritative explainer:

HHMI BioInteractive
How this is graded
For: CER — Written CER on the ethics of using an imperfect test: claim with conditions, evidence about false-result harms, reasoning, and rebuttal.
  • Complete
    Every required part of the artifact is present, nothing left blank.
  • Accurate
    The science and the data are correct and match the evidence.
  • Scientific reasoning
    You explain your claim with evidence and reasoning (CER), not just an answer.
  • Professional communication
    Clear, organized, labeled, and written the way a clinician or scientist would.
  • Submitted
    Turned in the right way (Schoology for routine work) and confirmed.
Submission Zone

Drop your Tue, Feb 16, 2027 · Bioethics debate: false results here. Use a clear file name (your initials + project). Routine work still goes to Schoology (via the CMSD portal).

Upload a project